Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

SNCAIP Antibody - middle region : FITC (ARP75263_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75263_P050 Unconjugated

ARP75263_P050-HRP Conjugated

ARP75263_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
SNCAIP
Official Gene Full Name:
synuclein alpha interacting protein
NCBI Gene Id:
9627
Protein Name:
synphilin-1
Swissprot Id:
Q9Y6H5-2
Alias Symbols:
Sph1, SYPH1
Description of Target:
This gene encodes a protein containing several protein-protein interaction domains, including ankyrin-like repeats, a coiled-coil domain, and an ATP/GTP-binding motif. The encoded protein interacts with alpha-synuclein in neuronal tissue and may play a role in the formation of cytoplasmic inclusions and neurodegeneration. A mutation in this gene has been associated with Parkinson's disease. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
603
Molecular Weight:
66kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SNCAIP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SNCAIP.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human SNCAP
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LHLMIKKHTLASGGRRFPFSIKASKSLDGHSPSPTSESSEPDLESQYPGS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
Pphln1; UBC; SNCA; PIN1; SNCAIP; PINK1; NUB1; PARK2; CSNK2A1; YWHAH; ARIH1; PSMC4; PPP1CA; NUDT21; C11orf58; HERPUD1; SIAH1; RNF19A; TLG2; VPS52; RGP1; YPT6; RIC1; GSK3B; SIAH2; GET4; UBB; SH2D3C; AGXT; SEPT4; AES; PTN; CSNK2B;
Blocking Peptide:
For anti-SNCAIP (ARP75263_P050-FITC) antibody is Catalog # AAP75263
Datasheets/Manuals:
Printable datasheet for anti-SNCAIP (ARP75263_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...