Search Antibody, Protein, and ELISA Kit Solutions

SNAPIN Antibody - middle region (ARP78221_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
SNAP associated protein
NCBI Gene Id:
Protein Name:
SNARE-associated protein Snapin
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-34944 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
14 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SNAPIN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SNAPIN.
The immunogen is a synthetic peptide directed towards the middle region of human SNAPIN
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: LDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SNAPIN (ARP78221_P050) antibody is Catalog # AAP78221
Printable datasheet for anti-SNAPIN (ARP78221_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...