Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP78221_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

SNAPIN Antibody - middle region (ARP78221_P050)

Catalog#: ARP78221_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-34944 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SNAPIN
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: LDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-SNAPIN (ARP78221_P050) antibody is Catalog # AAP78221
Datasheets/ManualsPrintable datasheet for anti-SNAPIN (ARP78221_P050) antibody
Gene SymbolSNAPIN
Official Gene Full NameSNAP associated protein
Alias SymbolsBLOS7, SNAPAP, BLOC1S7,
NCBI Gene Id23557
Protein NameSNARE-associated protein Snapin
Description of TargetThe protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants.
Swissprot IdO95295
Protein Accession #NP_036569.1
Nucleotide Accession #NM_012437.5
Protein Size (# AA)136
Molecular Weight14 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SNAPIN.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SNAPIN.
Write Your Own Review
You're reviewing:SNAPIN Antibody - middle region (ARP78221_P050)
Your Rating
Aviva ChIP Antibodies
Aviva Tips and Tricks
Aviva Travel Grant
Aviva Blast Tool