Search Antibody, Protein, and ELISA Kit Solutions

SNAPC3 Antibody - middle region (ARP34173_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34173_P050-FITC Conjugated

ARP34173_P050-HRP Conjugated

ARP34173_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Small nuclear RNA activating complex, polypeptide 3, 50kDa
NCBI Gene Id:
Protein Name:
snRNA-activating protein complex subunit 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC132011, MGC33124, PTFbeta, SNAP50
Description of Target:
SNAPC3 is part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. SNAPC3 binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. SNAP
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SNAPC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SNAPC3.
The immunogen is a synthetic peptide directed towards the middle region of human SNAPC3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SNAPC3 (ARP34173_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LRDSIRCVSDLQIGGEFSNTPDQAPEHISKDLYKSAFFYFEGTFYNDKRY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SNAPC3 (ARP34173_P050) antibody is Catalog # AAP34173 (Previous Catalog # AAPP05435)
Printable datasheet for anti-SNAPC3 (ARP34173_P050) antibody
Target Reference:
Jawdekar,G.W., (2006) J. Biol. Chem. 281 (41), 31050-31060

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...