Catalog No: OPCA05204
Price: $0.00
SKU
OPCA05204
Availability: Domestic: within 1-2 weeks delivery | International: 1-2 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
SNAKE VENOM METALLOPROTEINASE ADAMALYSIN-2 Recombinant Protein (Eastern diamondback rattlesnake) (OPCA05204)
Datasheets/Manuals | Printable datasheet for OPCA05204 |
---|
Predicted Species Reactivity | Eastern diamondback rattlesnake |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Crotalus adamanteus (Eastern diamondback rattlesnake) |
Reconstitution and Storage | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E. Coli |
Protein Range | 1-203 aa |
Tag | N-terminal 6xHis-tagged |
Reference | First structure of a snake venom metalloproteinase: a prototype for matrix metalloproteinases/collagenases. Gomis-Rueth F.-X., Kress L.F., Bode W. EMBO J. 12:4151-4157(1993) |
Alias Symbols | Adamalysin II Proteinase II |
---|---|
Protein Name | Snake venom metalloproteinase adamalysin-2 |
Description of Target | Has no significant hemorrhagic activity, but inactivates serpins by limited proteolysis of their reactive-site loops. |
Uniprot ID | P34179 |
Protein Size (# AA) | 1-203 aa |
Molecular Weight | 27.1 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review