Size:100 ul
$319.00
In Stock
SKU
ARP33314_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33314_P050-FITC Conjugated

ARP33314_P050-HRP Conjugated

ARP33314_P050-Biotin Conjugated

SNAI1 Antibody - N-terminal region (ARP33314_P050)

Rating:
80% of 100
Catalog#: ARP33314_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Guinea Pig, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10432 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SNAI1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rat: 100%
Complete computational species homology data Anti-SNAI1 (ARP33314_P050)
Peptide Sequence Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SNAI1 (ARP33314_P050) antibody is Catalog # AAP33314 (Previous Catalog # AAPP04356)
Datasheets/Manuals Printable datasheet for anti-SNAI1 (ARP33314_P050) antibody
Sample Type Confirmation

SNAI1 is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference Zhou,B.P., et al., (2004) Nat. Cell Biol. 6 (10), 931-940
Publications

Cooper, C. D. O. et al. Identification and characterization of peripheral T-cell lymphoma-associated SEREX antigens. PLoS One 6, e23916 (2011). IHC, WB, Guinea Pig, Human, Mouse, Rat 21914172

Surati, M. et al. Proteomic characterization of non-small cell lung cancer in a comprehensive translational thoracic oncology database. J. Clin. Bioinforma. 1, 1-11 (2011). IHC, WB, Guinea Pig, Human, Mouse, Rat 21603121

Wang, H. et al. PRL-3 down-regulates PTEN expression and signals through PI3K to promote epithelial-mesenchymal transition. Cancer Res. 67, 2922-6 (2007). IHC, WB, Guinea Pig, Human, Mouse, Rat 17409395

Gene Symbol SNAI1
Official Gene Full Name Snail homolog 1 (Drosophila)
Alias Symbols SNA, SNAH, SNAIL, SLUGH2, SNAIL1, dJ710H13.1
NCBI Gene Id 6615
Protein Name Zinc finger protein SNAI1
Description of Target The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo.
Swissprot Id O95863
Protein Accession # NP_005976
Nucleotide Accession # NM_005985
Protein Size (# AA) 264
Molecular Weight 29kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SNAI1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SNAI1.
Protein Interactions MTUS2; KRT31; TRIM23; ACTN2; MID2; NOTCH2NL; KRTAP10-3; KRT40; FBXL5; EZH2; RNF2; RING1; LATS2; UBC; BTRC; TP53; MDM2; GSK3B; HDAC1; CHD4; KDM1A; HDAC3; HDAC2; RCOR1; FBXL14; NOTCH1; HIST1H3A; EGR1; AJUBA; Sin3a; HOXD4; SUZ12; CTDSP1; CTDSPL; CTDSP2; QRIC
  1. What is the species homology for "SNAI1 Antibody - N-terminal region (ARP33314_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Guinea Pig, Human, Mouse, Rat".

  2. How long will it take to receive "SNAI1 Antibody - N-terminal region (ARP33314_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SNAI1 Antibody - N-terminal region (ARP33314_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SNAI1 Antibody - N-terminal region (ARP33314_P050)"?

    This target may also be called "SNA, SNAH, SNAIL, SLUGH2, SNAIL1, dJ710H13.1" in publications.

  5. What is the shipping cost for "SNAI1 Antibody - N-terminal region (ARP33314_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SNAI1 Antibody - N-terminal region (ARP33314_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SNAI1 Antibody - N-terminal region (ARP33314_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SNAI1 Antibody - N-terminal region (ARP33314_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SNAI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SNAI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SNAI1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SNAI1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SNAI1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SNAI1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SNAI1 Antibody - N-terminal region (ARP33314_P050)
Your Rating
We found other products you might like!