Search Antibody, Protein, and ELISA Kit Solutions

SNAG1 Antibody - middle region (ARP58951_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58951_P050-FITC Conjugated

ARP58951_P050-HRP Conjugated

ARP58951_P050-Biotin Conjugated

Gene Symbol:
SNX18
Official Gene Full Name:
Sorting nexin 18
NCBI Gene Id:
112574
Protein Name:
Sorting nexin-18
Swissprot Id:
Q96RF0-2
Protein Accession #:
NP_001096045
Nucleotide Accession #:
NM_001102575
Alias Symbols:
FLJ11997, FLJ32560, FLJ61062, MGC150827, MGC150829, SH3PX2, SH3PXD3B, SNAG1
Replacement Item:
This antibody may replace item sc-165518 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a SH3 domain. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
624
Molecular Weight:
69kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SNAG1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SNAG1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SNAG1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SNAG1 (ARP58951_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ANKRD28; GRB2; CBL; CUL1; FASLG; UBC; ITCH; SOS2; SOS1;
Blocking Peptide:
For anti-SNX18 (ARP58951_P050) antibody is Catalog # AAP58951 (Previous Catalog # AAPP44923)
Datasheets/Manuals:
Printable datasheet for anti-SNX18 (ARP58951_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...