Search Antibody, Protein, and ELISA Kit Solutions

SMYD3 Antibody - N-terminal region (ARP50666_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP50666_P050-FITC Conjugated

ARP50666_P050-HRP Conjugated

ARP50666_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-173215 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SMYD3
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-SMYD3 (ARP50666_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SMYD3 (ARP50666_P050) antibody is Catalog # AAP50666 (Previous Catalog # AAPY03385)
Datasheets/Manuals:
Printable datasheet for anti-SMYD3 (ARP50666_P050) antibody
Target Reference:
Silva,F.P., (2008) Oncogene 27 (19), 2686-2692
Gene Symbol:
SMYD3
Official Gene Full Name:
SET and MYND domain containing 3
Alias Symbols:
FLJ21080, MGC104324, ZMYND1, ZNFN3A1, bA74P14.1, KMT3E
NCBI Gene Id:
64754
Protein Name:
SET and MYND domain-containing protein 3
Description of Target:
SMYD3 is a member of an RNA polymerase complex. Within the RNA polymerase complex, it acts as a histone methyltransferase that plays a role in transcriptional regulation.SMYD3 is a histone methyltransferase that plays a role in transcriptional regulation as a member of an RNA polymerase complex.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Q9H7B4-3
Protein Accession #:
NP_073580
Nucleotide Accession #:
NM_022743
Protein Size (# AA):
369
Molecular Weight:
42kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMYD3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMYD3.
Protein Interactions:
CDC37; H3F3C; ZNF557; TRIT1; VANGL1; HCVgp1; CYP39A1; NFYB; NDUFAB1; CAMK2B; APP; EED; EZH2; UBC; ESR1; HELZ; PBX2; POLR2K; HSP90AA1; HIST3H3; POLR2A; MEST;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...