Search Antibody, Protein, and ELISA Kit Solutions

SMYD2 Antibody - middle region (ARP50639_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP50639_P050-FITC Conjugated

ARP50639_P050-HRP Conjugated

ARP50639_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-130879 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SMYD2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-SMYD2 (ARP50639_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SMYD2 (ARP50639_P050) antibody is Catalog # AAP50639 (Previous Catalog # AAPS26509)
Datasheets/Manuals:
Printable datasheet for anti-SMYD2 (ARP50639_P050) antibody
Sample Type Confirmation:

SMYD2 is supported by BioGPS gene expression data to be expressed in SHSY5Y

Target Reference:
Suzuki,H., (2008) Mol. Cell Proteomics 7 (3), 560-572
Gene Symbol:
SMYD2
Official Gene Full Name:
SET and MYND domain containing 2
Alias Symbols:
HSKM-B, KMT3C, MGC119305, ZMYND14
NCBI Gene Id:
56950
Protein Name:
N-lysine methyltransferase SMYD2
Description of Target:
The specific function of this protein remains unknown.SET domain-containing proteins, such as SMYD2, catalyze lysine methylation (Brown et al., 2006 [PubMed 16805913]).[supplied by OMIM].
Swissprot Id:
Q9NRG4
Protein Accession #:
NP_064582
Nucleotide Accession #:
NM_020197
Protein Size (# AA):
433
Molecular Weight:
50kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMYD2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMYD2.
Protein Interactions:
UBC; HIST2H3C; HSP90AA1; RB1; EPB41L3; TP53; CLASP2; AKAP11; CDC37; IGF2BP1; AXIN1; GSK3B;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...