Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

SMYD1 Antibody - N-terminal region (ARP37022_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37022_P050-FITC Conjugated

ARP37022_P050-HRP Conjugated

ARP37022_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
SET and MYND domain containing 1
NCBI Gene Id:
Protein Name:
SET and MYND domain-containing protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Bop, C78565, Zmynd18, 4632404M21Rik
Replacement Item:
This antibody may replace item sc-177956 from Santa Cruz Biotechnology.
Description of Target:
SMYD1 is a histone methyltransferases and plays a critical role in myofibril organization during myofiber maturation
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMYD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMYD1.
The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMYD1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SMYD1 (ARP37022_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Trp53; Naca; Hdac1; Hdac3; Hdac2;
Blocking Peptide:
For anti-SMYD1 (ARP37022_P050) antibody is Catalog # AAP37022 (Previous Catalog # AAPP09220)
Printable datasheet for anti-SMYD1 (ARP37022_P050) antibody
Target Reference:
Phan,D., et al., (2005) Development 132 (11), 2669-2678

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...