SMYD1 Antibody - middle region (ARP50862_P050)

Catalog No: ARP50862_P050

WB Suggested Anti-SMYD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMYD1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: AVMRAGLTNWHAGNIEVGHGMICKAYAILLVTHGPSHPITKDLEAMRVQT
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP50862 (Previous Catalog # AAPS26607)
• Reference: Sims,R.J. (2002) J. Biol. Chem. 277 (29), 26524-26529

Target Info

• Gene Symbol: SMYD1
• Gene Full Name: SET and MYND domain containing 1
• Alias Symbols: BOP, KMT3D, ZMYND18, ZMYND22
• NCBI Gene Id: 150572
• Protein Name: SET and MYND domain-containing protein 1
• Description of Target: SMYD1 acts as a transcriptional repressor. SMYD1 is essential for cardiomyocyte differentiation and cardiac morphogenesis.
• Uniprot ID: Q8NB12
• Protein Accession #: NP_938015
• Nucleotide Accession #: NM_198274
• Protein Size (# AA): 490
• Molecular Weight: 56kDa
• Protein Interactions: HOMEZ; ZBTB44; BHLHE40; TTC33; UTP14A; ADSS; CCDC113; H3F3C; C11orf53; LENG8; RBM4B; WDR77; FAM204A; MYH7B; C11orf16; OGDHL; HDAC3; HDAC2; NACA;