SMR3B Antibody - middle region (ARP42311_P050)

Catalog No: ARP42311_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: SMR3B
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Human: 100%; Yeast: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SMR3B (ARP42311_P050) antibody is Catalog # AAP42311

Target Info

• Gene Symbol: SMR3B
• Gene Full Name: Submaxillary gland androgen regulated protein 3B
• Alias Symbols: P-B, PBII, PRL3, PROL3, SMR1B
• NCBI Gene Id: 10879
• Protein Name: Submaxillary gland androgen-regulated protein 3B
• Description of Target: The function of this protein remains unknown.
• Uniprot ID: P02814
• Protein Accession #: NP_006676
• Nucleotide Accession #: NM_006685
• Protein Size (# AA): 79
• Molecular Weight: 8kDa
• Protein Interactions: UBQLN1; RAD21;