Search Antibody, Protein, and ELISA Kit Solutions

SMC3 Antibody - N-terminal region (ARP47592_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP47592_P050-FITC Conjugated

ARP47592_P050-HRP Conjugated

ARP47592_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
SMC3
Official Gene Full Name:
Structural maintenance of chromosomes 3
NCBI Gene Id:
9126
Protein Name:
Structural maintenance of chromosomes protein 3
Swissprot Id:
Q9UQE7
Protein Accession #:
NP_005436
Nucleotide Accession #:
NM_005445
Alias Symbols:
BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1
Replacement Item:
This antibody may replace item sc-292645 from Santa Cruz Biotechnology.
Description of Target:
SMC3 belongs to the SMC3 subfamily of SMC proteins. SMC3 occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation.
Protein Size (# AA):
1217
Molecular Weight:
141kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMC3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SMC3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-SMC3 (ARP47592_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KWDKMRRALEYTIYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDAR
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO2; UBC; RPA3; RPA2; RPA1; SUZ12; EED; RNF2; FBXO6; ANKRD28; HDAC11; HDAC8; HDAC9; SOX2; RAD21; CDCA5; PDS5A; WAPAL; MMS19; METTL21B; NOTCH1; SMC1A; SFPQ; HNRNPM; NSMCE2; UBD; COPS5; COPS6; CUL2; CUL3; NEDD8; CDK2; FBXO25; MECP2; NIPBL; CDK8; SUPT5H; P
Blocking Peptide:
For anti-SMC3 (ARP47592_P050) antibody is Catalog # AAP47592 (Previous Catalog # AAPP28452)
Datasheets/Manuals:
Printable datasheet for anti-SMC3 (ARP47592_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that SMC3 is expressed in COLO205

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...