Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP47590_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47590_P050-FITC Conjugated

ARP47590_P050-HRP Conjugated

ARP47590_P050-Biotin Conjugated

SMC3 Antibody - C-terminal region (ARP47590_P050)

Catalog#: ARP47590_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-292645 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SMC3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-SMC3 (ARP47590_P050)
Peptide Sequence Synthetic peptide located within the following region: GKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SMC3 (ARP47590_P050) antibody is Catalog # AAP47590 (Previous Catalog # AAPP13005)
Datasheets/Manuals Printable datasheet for anti-SMC3 (ARP47590_P050) antibody
Sample Type Confirmation

There is BioGPS gene expression data showing that SMC3 is expressed in HepG2

Gene Symbol SMC3
Official Gene Full Name Structural maintenance of chromosomes 3
Alias Symbols BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1
NCBI Gene Id 9126
Protein Name Structural maintenance of chromosomes protein 3
Description of Target SMC3 belongs to the SMC3 subfamily of SMC proteins. SMC3 occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation.
Swissprot Id Q9UQE7
Protein Accession # AAD32447
Nucleotide Accession # NM_005445
Protein Size (# AA) 681
Molecular Weight 74kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SMC3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SMC3.
Protein Interactions SUMO2; UBC; RPA3; RPA2; RPA1; SUZ12; EED; RNF2; FBXO6; ANKRD28; HDAC11; HDAC8; HDAC9; SOX2; RAD21; CDCA5; PDS5A; WAPAL; MMS19; METTL21B; NOTCH1; SMC1A; SFPQ; HNRNPM; NSMCE2; UBD; COPS5; COPS6; CUL2; CUL3; NEDD8; CDK2; FBXO25; MECP2; NIPBL; CDK8; SUPT5H; P
  1. What is the species homology for "SMC3 Antibody - C-terminal region (ARP47590_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "SMC3 Antibody - C-terminal region (ARP47590_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SMC3 Antibody - C-terminal region (ARP47590_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SMC3 Antibody - C-terminal region (ARP47590_P050)"?

    This target may also be called "BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1" in publications.

  5. What is the shipping cost for "SMC3 Antibody - C-terminal region (ARP47590_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SMC3 Antibody - C-terminal region (ARP47590_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SMC3 Antibody - C-terminal region (ARP47590_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "74kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SMC3 Antibody - C-terminal region (ARP47590_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SMC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SMC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SMC3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SMC3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SMC3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SMC3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SMC3 Antibody - C-terminal region (ARP47590_P050)
Your Rating
We found other products you might like!