Search Antibody, Protein, and ELISA Kit Solutions

SMC3 Antibody - C-terminal region (ARP47590_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP47590_P050-FITC Conjugated

ARP47590_P050-HRP Conjugated

ARP47590_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Structural maintenance of chromosomes 3
NCBI Gene Id:
Protein Name:
Structural maintenance of chromosomes protein 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-292645 from Santa Cruz Biotechnology.
Description of Target:
SMC3 belongs to the SMC3 subfamily of SMC proteins. SMC3 occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMC3.
The immunogen is a synthetic peptide directed towards the C terminal region of human SMC3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-SMC3 (ARP47590_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRV
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SMC3 (ARP47590_P050) antibody is Catalog # AAP47590 (Previous Catalog # AAPP13005)
Printable datasheet for anti-SMC3 (ARP47590_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that SMC3 is expressed in HepG2

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...