SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP38224_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP38224_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

SMARCE1 Antibody - N-terminal region : Biotin (ARP38224_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-SMARCE1 (ARP38224_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SMARCE1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSR
Concentration0.5 mg/ml
Blocking PeptideFor anti-SMARCE1 (ARP38224_P050-Biotin) antibody is Catalog # AAPS05009
Sample Type Confirmation

SMARCE1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceChen,J. (2005) Mol. Cell. Biol. 25 (20), 9016-9027
Gene SymbolSMARCE1
Gene Full NameSWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
Alias SymbolsCSS5, BAF57
NCBI Gene Id6605
Protein NameSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
Description of TargetSMARCE1 is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.
Uniprot IDQ969G3
Protein Accession #NP_003070
Nucleotide Accession #NM_003079
Protein Size (# AA)411
Molecular Weight47kDa
Protein InteractionsNOTCH2NL; KRTAP10-9; CCDC172; NBPF22P; TXLNA; MIPOL1; KRT40; MRFAP1L1; SYCE1; ING5; USHBP1; CEP70; CEP63; CCDC136; RINT1; TRIM54; AMOTL2; MED4; TFIP11; NUP62; MTUS2; EXOC7; RALBP1; SPAG5; JAKMIP2; TRIP10; STX11; CEP170P1; MEOX2; KRT31; KRT15; KIFC3; GOLGA
  1. What is the species homology for "SMARCE1 Antibody - N-terminal region : Biotin (ARP38224_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "SMARCE1 Antibody - N-terminal region : Biotin (ARP38224_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SMARCE1 Antibody - N-terminal region : Biotin (ARP38224_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SMARCE1 Antibody - N-terminal region : Biotin (ARP38224_P050-Biotin)"?

    This target may also be called "CSS5, BAF57" in publications.

  5. What is the shipping cost for "SMARCE1 Antibody - N-terminal region : Biotin (ARP38224_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SMARCE1 Antibody - N-terminal region : Biotin (ARP38224_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SMARCE1 Antibody - N-terminal region : Biotin (ARP38224_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SMARCE1 Antibody - N-terminal region : Biotin (ARP38224_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SMARCE1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SMARCE1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SMARCE1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SMARCE1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SMARCE1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SMARCE1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SMARCE1 Antibody - N-terminal region : Biotin (ARP38224_P050-Biotin)
Your Rating
We found other products you might like!