Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP38224_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38224_P050-FITC Conjugated

ARP38224_P050-HRP Conjugated

ARP38224_P050-Biotin Conjugated

SMARCE1 Antibody - N-terminal region (ARP38224_P050)

Rating:
87% of 100
Catalog#: ARP38224_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-25140 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCE1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-SMARCE1 (ARP38224_P050)
Peptide Sequence Synthetic peptide located within the following region: MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SMARCE1 (ARP38224_P050) antibody is Catalog # AAPS05009
Datasheets/Manuals Printable datasheet for anti-SMARCE1 (ARP38224_P050) antibody
Sample Type Confirmation

SMARCE1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Chen,J. (2005) Mol. Cell. Biol. 25 (20), 9016-9027
Gene Symbol SMARCE1
Official Gene Full Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
Alias Symbols BAF57
NCBI Gene Id 6605
Protein Name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
Description of Target SMARCE1 is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.
Swissprot Id Q969G3
Protein Accession # NP_003070
Nucleotide Accession # NM_003079
Protein Size (# AA) 411
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SMARCE1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SMARCE1.
Protein Interactions NOTCH2NL; KRTAP10-9; CCDC172; NBPF22P; TXLNA; MIPOL1; KRT40; MRFAP1L1; SYCE1; ING5; USHBP1; CEP70; CEP63; CCDC136; RINT1; TRIM54; AMOTL2; MED4; TFIP11; NUP62; MTUS2; EXOC7; RALBP1; SPAG5; JAKMIP2; TRIP10; STX11; CEP170P1; MEOX2; KRT31; KRT15; KIFC3; GOLGA
Write Your Own Review
You're reviewing:SMARCE1 Antibody - N-terminal region (ARP38224_P050)
Your Rating