ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP58324_P050
Price: $0.00
SKU
ARP58324_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SMARCD1 (ARP58324_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SMARCD1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-SMARCD1 (ARP58324_P050) antibody is Catalog # AAP58324 (Previous Catalog # AAPP32934)
ReferenceAssmann,E.M., (2006) J. Biol. Chem. 281 (15), 9869-9881
Gene SymbolSMARCD1
Gene Full NameSWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
Alias SymbolsCSS11, Rsc6p, BAF60A, CRACD1
NCBI Gene Id6602
Protein NameSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
Description of TargetSMARCD1 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. It is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ96GM5
Protein Accession #NP_003067
Nucleotide Accession #NM_003076
Protein Size (# AA)515
Molecular Weight58kDa
Protein InteractionsMED4; VPS37B; UBC; KDM1A; PRMT6; YAP1; CALCOCO2; MMS19; RPS29; PRDX1; NUCB2; NME1; KRT18; IGKC; HSPB1; HNRNPC; CDC5L; C4BPA; APOA5; GCC1; RIF1; EGFL7; SUV420H1; CORO1A; PAICS; ANP32B; YWHAG; TP53BP1; ARID1B; PHF10; NCOR1; HDAC3; ARID1A; SMARCE1; SMARCD2;
  1. What is the species homology for "SMARCD1 Antibody - middle region (ARP58324_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "SMARCD1 Antibody - middle region (ARP58324_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SMARCD1 Antibody - middle region (ARP58324_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SMARCD1 Antibody - middle region (ARP58324_P050)"?

    This target may also be called "CSS11, Rsc6p, BAF60A, CRACD1" in publications.

  5. What is the shipping cost for "SMARCD1 Antibody - middle region (ARP58324_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SMARCD1 Antibody - middle region (ARP58324_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SMARCD1 Antibody - middle region (ARP58324_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SMARCD1 Antibody - middle region (ARP58324_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SMARCD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SMARCD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SMARCD1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SMARCD1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SMARCD1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SMARCD1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SMARCD1 Antibody - middle region (ARP58324_P050)
Your Rating