Search Antibody, Protein, and ELISA Kit Solutions

SMARCAL1 Antibody - N-terminal region : FITC (ARP72950_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72950_P050 Unconjugated

ARP72950_P050-HRP Conjugated

ARP72950_P050-Biotin Conjugated

Gene Symbol:
SMARCAL1
NCBI Gene Id:
50485
Swissprot Id:
Q9NZC9
Protein Accession #:
XP_005246689
Alias Symbols:
SMARCAL1, HARP,
Replacement Item:
This antibody may replace item sc-113334 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein shows sequence similarity to the E. coli RNA polymerase-binding protein HepA. Mutations in this gene are a cause of Schimke immunoosseous dysplasia (SIOD), an autosomal recessive disorder with the diagnostic features of spondyloepiphyseal dysplasia, renal dysfunction, and T-cell immunodeficiency.
Protein Size (# AA):
954
Molecular Weight:
104kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMARCAL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMARCAL1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SMARCAL1
Predicted Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Peptide Sequence:
Synthetic peptide located within the following region: QNLSSSSNADQRPHDSHSFQAKGIWKKPEEMPTACPGHSPRSQMALTGIS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
UBC; RPA3; RPA2; RPA1; SULT1A1; Cebpb;
Blocking Peptide:
For anti-SMARCAL1 (ARP72950_P050-FITC) antibody is Catalog # AAP72950
Datasheets/Manuals:
Printable datasheet for anti-SMARCAL1 (ARP72950_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...