Search Antibody, Protein, and ELISA Kit Solutions

SMARCA5 Antibody - N-terminal region (ARP30031_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP30031_P050-FITC Conjugated

ARP30031_P050-HRP Conjugated

ARP30031_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
CHIP, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-113724 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCA5
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-SMARCA5 (ARP30031_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SMARCA5 (ARP30031_P050) antibody is Catalog # AAP30031 (Previous Catalog # AAPH00207)
Datasheets/Manuals:
Printable datasheet for anti-SMARCA5 (ARP30031_P050) antibody
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Gene Symbol:
SMARCA5
Official Gene Full Name:
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
Alias Symbols:
ISWI, SNF2H, WCRF135, hISWI, hSNF2H
NCBI Gene Id:
8467
Protein Name:
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
Description of Target:
SMARCA5 is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA5 is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II.The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
O60264
Protein Accession #:
NP_003592
Nucleotide Accession #:
NM_003601
Protein Size (# AA):
1052
Molecular Weight:
122kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMARCA5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMARCA5.
Protein Interactions:
SUMO2; SUMO3; HIST1H3A; UBC; RPA3; RPA2; RPA1; SUZ12; EED; RNF2; BMI1; HB-1; AT5G35210; LMNA; RSF1; BAZ1A; SMARCA5; WHSC1; SS18; SSX2; UL29; RNF168; VCP; NOTCH1; IK; HDAC2; HDAC1; CHRAC1; MBD3; PHGDH; NCSTN; POLR3A; RUVBL2; RBM14; SAP18; HNRNPR; EIF4A3; B

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...