Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP30031_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30031_P050-FITC Conjugated

ARP30031_P050-HRP Conjugated

ARP30031_P050-Biotin Conjugated

SMARCA5 Antibody - N-terminal region (ARP30031_P050)

Catalog#: ARP30031_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application CHIP, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-113724 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCA5
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data Anti-SMARCA5 (ARP30031_P050)
Peptide Sequence Synthetic peptide located within the following region: AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SMARCA5 (ARP30031_P050) antibody is Catalog # AAP30031 (Previous Catalog # AAPH00207)
Datasheets/Manuals Printable datasheet for anti-SMARCA5 (ARP30031_P050) antibody
Target Reference Olsen,J.V., (2006) Cell 127 (3), 635-648
Gene Symbol SMARCA5
Official Gene Full Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
Alias Symbols ISWI, SNF2H, WCRF135, hISWI, hSNF2H
NCBI Gene Id 8467
Protein Name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
Description of Target SMARCA5 is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA5 is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II.The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id O60264
Protein Accession # NP_003592
Nucleotide Accession # NM_003601
Protein Size (# AA) 1052
Molecular Weight 122kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SMARCA5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SMARCA5.
Protein Interactions SUMO2; SUMO3; HIST1H3A; UBC; RPA3; RPA2; RPA1; SUZ12; EED; RNF2; BMI1; HB-1; AT5G35210; LMNA; RSF1; BAZ1A; SMARCA5; WHSC1; SS18; SSX2; UL29; RNF168; VCP; NOTCH1; IK; HDAC2; HDAC1; CHRAC1; MBD3; PHGDH; NCSTN; POLR3A; RUVBL2; RBM14; SAP18; HNRNPR; EIF4A3; B
  1. What is the species homology for "SMARCA5 Antibody - N-terminal region (ARP30031_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat".

  2. How long will it take to receive "SMARCA5 Antibody - N-terminal region (ARP30031_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SMARCA5 Antibody - N-terminal region (ARP30031_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SMARCA5 Antibody - N-terminal region (ARP30031_P050)"?

    This target may also be called "ISWI, SNF2H, WCRF135, hISWI, hSNF2H" in publications.

  5. What is the shipping cost for "SMARCA5 Antibody - N-terminal region (ARP30031_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SMARCA5 Antibody - N-terminal region (ARP30031_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SMARCA5 Antibody - N-terminal region (ARP30031_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "122kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SMARCA5 Antibody - N-terminal region (ARP30031_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SMARCA5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SMARCA5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SMARCA5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SMARCA5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SMARCA5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SMARCA5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SMARCA5 Antibody - N-terminal region (ARP30031_P050)
Your Rating
We found other products you might like!