Search Antibody, Protein, and ELISA Kit Solutions

SMARCA5 Antibody - N-terminal region (ARP30031_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30031_P050-FITC Conjugated

ARP30031_P050-HRP Conjugated

ARP30031_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
NCBI Gene Id:
Protein Name:
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-113724 from Santa Cruz Biotechnology.
Description of Target:
SMARCA5 is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA5 is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II.The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMARCA5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMARCA5.
The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCA5
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-SMARCA5 (ARP30031_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SMARCA5 (ARP30031_P050) antibody is Catalog # AAP30031 (Previous Catalog # AAPH00207)
Printable datasheet for anti-SMARCA5 (ARP30031_P050) antibody
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...