Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP30031_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30031_P050-FITC Conjugated

ARP30031_P050-HRP Conjugated

ARP30031_P050-Biotin Conjugated

SMARCA5 Antibody - N-terminal region (ARP30031_P050)

Catalog#: ARP30031_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationCHIP, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-113724 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SMARCA5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology dataAnti-SMARCA5 (ARP30031_P050)
Peptide SequenceSynthetic peptide located within the following region: AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-SMARCA5 (ARP30031_P050) antibody is Catalog # AAP30031 (Previous Catalog # AAPH00207)
Datasheets/ManualsPrintable datasheet for anti-SMARCA5 (ARP30031_P050) antibody
Target ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Gene SymbolSMARCA5
Official Gene Full NameSWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
Alias SymbolsISWI, SNF2H, WCRF135, hISWI, hSNF2H
NCBI Gene Id8467
Protein NameSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
Description of TargetSMARCA5 is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA5 is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II.The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdO60264
Protein Accession #NP_003592
Nucleotide Accession #NM_003601
Protein Size (# AA)1052
Molecular Weight122kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SMARCA5.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SMARCA5.
Protein InteractionsSUMO2; SUMO3; HIST1H3A; UBC; RPA3; RPA2; RPA1; SUZ12; EED; RNF2; BMI1; HB-1; AT5G35210; LMNA; RSF1; BAZ1A; SMARCA5; WHSC1; SS18; SSX2; UL29; RNF168; VCP; NOTCH1; IK; HDAC2; HDAC1; CHRAC1; MBD3; PHGDH; NCSTN; POLR3A; RUVBL2; RBM14; SAP18; HNRNPR; EIF4A3; B
Write Your Own Review
You're reviewing:SMARCA5 Antibody - N-terminal region (ARP30031_P050)
Your Rating
Aviva Blast Tool
Aviva Validation Data
Aviva ChIP Antibodies
Aviva HIS tag Deal