Search Antibody, Protein, and ELISA Kit Solutions

SMARCA1 Antibody - N-terminal region (ARP37435_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37435_T100-FITC Conjugated

ARP37435_T100-HRP Conjugated

ARP37435_T100-Biotin Conjugated

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
CHIP, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-367689 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMARCA1
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-SMARCA1 (ARP37435_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SMARCA1 (ARP37435_T100) antibody is Catalog # AAP37435 (Previous Catalog # AAPP09810)
Datasheets/Manuals:
Printable datasheet for anti-SMARCA1 (ARP37435_T100) antibody
Target Reference:
Okazaki,Y., et al., (2002) Nature 420 (6915), 563-573
Gene Symbol:
SMARCA1
Official Gene Full Name:
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
Alias Symbols:
Snf2l, 5730494M04Rik
NCBI Gene Id:
93761
Protein Name:
Probable global transcription activator SNF2L1 Ensembl ENSMUSP00000135570
Description of Target:
cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science Laboratory in RIKEN.
Swissprot Id:
Q8BS67
Protein Accession #:
BAC28931
Nucleotide Accession #:
NM_053123
Protein Size (# AA):
381
Molecular Weight:
43kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMARCA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMARCA1.
Protein Interactions:
Eed; Ewsr1; Baz1a;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...