Size:100 ul
$229.00
In Stock
SKU
ARP37435_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37435_T100-FITC Conjugated

ARP37435_T100-HRP Conjugated

ARP37435_T100-Biotin Conjugated

SMARCA1 Antibody - N-terminal region (ARP37435_T100)

Catalog#: ARP37435_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application CHIP, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-367689 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMARCA1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Mouse: 100%; Rat: 100%
Complete computational species homology data Anti-SMARCA1 (ARP37435_T100)
Peptide Sequence Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SMARCA1 (ARP37435_T100) antibody is Catalog # AAP37435 (Previous Catalog # AAPP09810)
Datasheets/Manuals Printable datasheet for anti-SMARCA1 (ARP37435_T100) antibody
Target Reference Okazaki,Y., et al., (2002) Nature 420 (6915), 563-573
Gene Symbol SMARCA1
Official Gene Full Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
Alias Symbols Snf2l, 5730494M04Rik
NCBI Gene Id 93761
Protein Name Probable global transcription activator SNF2L1 Ensembl ENSMUSP00000135570
Description of Target cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science Laboratory in RIKEN.
Swissprot Id Q8BS67
Protein Accession # BAC28931
Nucleotide Accession # NM_053123
Protein Size (# AA) 381
Molecular Weight 43kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SMARCA1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SMARCA1.
Protein Interactions Eed; Ewsr1; Baz1a;
  1. What is the species homology for "SMARCA1 Antibody - N-terminal region (ARP37435_T100)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse, Rat".

  2. How long will it take to receive "SMARCA1 Antibody - N-terminal region (ARP37435_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SMARCA1 Antibody - N-terminal region (ARP37435_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SMARCA1 Antibody - N-terminal region (ARP37435_T100)"?

    This target may also be called "Snf2l, 5730494M04Rik" in publications.

  5. What is the shipping cost for "SMARCA1 Antibody - N-terminal region (ARP37435_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SMARCA1 Antibody - N-terminal region (ARP37435_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SMARCA1 Antibody - N-terminal region (ARP37435_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SMARCA1 Antibody - N-terminal region (ARP37435_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SMARCA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SMARCA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SMARCA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SMARCA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SMARCA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SMARCA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SMARCA1 Antibody - N-terminal region (ARP37435_T100)
Your Rating
We found other products you might like!