Search Antibody, Protein, and ELISA Kit Solutions

Smad6 Antibody - C-terminal region (ARP32689_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32689_P050-FITC Conjugated

ARP32689_P050-HRP Conjugated

ARP32689_P050-Biotin Conjugated

Gene Symbol:
Smad6
Official Gene Full Name:
SMAD family member 6
NCBI Gene Id:
17130
Protein Name:
Mothers against decapentaplegic homolog 6
Swissprot Id:
O35182
Replacement Item:
This antibody may replace item sc-13048 from Santa Cruz Biotechnology.
Description of Target:
Smad6 binds to regulatory elements in target promoter regions. It may block the BMP-SMAD1 signaling pathway by competing with SMAD4 for receptor-activated SMAD1-binding. It acts as a mediator of TGF-beta and BMP antiflammatory activity. It suppresses IL1R-TLR signaling through its direct interaction with PEL1, preventing NF-kappa-B activation, nuclear transport and NF-kappa-B-mediated expression of proinflammatory genes.
Protein Size (# AA):
459
Molecular Weight:
54kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMAD6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMAD6.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Smad6
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-SMAD6 (ARP32689_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Smurf1; Tbx6; Bmpr2; Bmpr1a; Acvr1; Runx2; tob1a; Axin1; SMURF2; BMPR1B;
Blocking Peptide:
For anti-SMAD6 (ARP32689_P050) antibody is Catalog # AAP32689
Datasheets/Manuals:
Printable datasheet for anti-SMAD6 (ARP32689_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...