Protein on Demand™ SMAD5 Recombinant Protein (Human) (OPCA321189)

Datasheets/Manuals	Printable datasheet for OPCA321189

Product Info
Predicted Species Reactivity	Human
Product Format	Liquid
Application	WB, ELISA
Additional Information	For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request.
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	TSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	2-465

Gene Full Name	SMAD family member 5
Alias Symbols	DWFC, JV5-1, MADH5
NCBI Gene Id	4090
Protein Name	mothers against decapentaplegic homolog 5
Description of Target	The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins typ
Uniprot ID	Q99717
Protein Accession #	NP_001001419.1
Nucleotide Accession #	NM_001001419.2
Protein Size (# AA)	464