Catalog No: OPCA321189
Price: $0.00
SKU
OPCA321189
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ SMAD5 Recombinant Protein (Human) (OPCA321189)
Datasheets/Manuals | Printable datasheet for OPCA321189 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Additional Information | For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request. |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | TSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 2-465 |
Gene Full Name | SMAD family member 5 |
---|---|
Alias Symbols | DWFC, JV5-1, MADH5 |
NCBI Gene Id | 4090 |
Protein Name | mothers against decapentaplegic homolog 5 |
Description of Target | The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins typ |
Uniprot ID | Q99717 |
Protein Accession # | NP_001001419.1 |
Nucleotide Accession # | NM_001001419.2 |
Protein Size (# AA) | 464 |
Write Your Own Review