Catalog No: P100621_T100
Price: $0.00
SKU
P100621_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SMAD3 (P100621_T100) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: FTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAIT
Concentration1.0 mg/ml
Blocking PeptideFor anti-SMAD3 (P100621_T100) antibody is Catalog # AAP30955 (Previous Catalog # AAPP01679)
ReferenceCheng,P.L., et al., (2004) Oncogene 23 (47), 7821-7838
Gene SymbolSMAD3
Gene Full NameSMAD family member 3
Alias SymbolsLDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436
NCBI Gene Id4088
Description of TargetSMAD3 is a member of Smad family proteins. SMAD family is known to be important cytoplasmic mediators of signals from the transforming growth factor-beta (TGF-beta) receptor serine/threonine kinases.
Uniprot IDP84022
Protein Accession #NP_005893
Nucleotide Accession #NM_005902
Protein Size (# AA)425
Molecular Weight48kDa
Protein InteractionsTEKT4; CCDC33; CPSF7; MEOX2; HDAC1; PHC2; WWP1; AES; BLZF1; UBC; TP53; SMAD4; BACH1; MAFK; FOXO3; NEDD8; TRIM33; WWP2; SMURF2; FOXM1; TRIM62; TP63; OTUB1; NEDD4L; BAG3; TGFB1I1; CSNK1D; RUNX1; HCVgp1; TSC2; FHL3; FHL2; FHL1; Melk; IRF7; RNF111; LCK; KLF5;
  1. What is the species homology for "SMAD3 Antibody - N-terminal region (P100621_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Zebrafish".

  2. How long will it take to receive "SMAD3 Antibody - N-terminal region (P100621_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SMAD3 Antibody - N-terminal region (P100621_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SMAD3 Antibody - N-terminal region (P100621_T100)"?

    This target may also be called "LDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436" in publications.

  5. What is the shipping cost for "SMAD3 Antibody - N-terminal region (P100621_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SMAD3 Antibody - N-terminal region (P100621_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SMAD3 Antibody - N-terminal region (P100621_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SMAD3 Antibody - N-terminal region (P100621_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SMAD3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SMAD3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SMAD3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SMAD3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SMAD3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SMAD3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SMAD3 Antibody - N-terminal region (P100621_T100)
Your Rating
We found other products you might like!