Search Antibody, Protein, and ELISA Kit Solutions

SMAD3 Antibody - N-terminal region (ARP97316_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
SMAD family member 3
NCBI Gene Id:
Protein Name:
Mothers against decapentaplegic homolog 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
LDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436
Description of Target:
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis.
Protein Size (# AA):
Molecular Weight:
46 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMAD3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMAD3.
The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: SILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SMAD3 (ARP97316_P050) antibody is Catalog # AAP97316
Printable datasheet for anti-SMAD3 (ARP97316_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...