Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP97316_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

SMAD3 Antibody - N-terminal region (ARP97316_P050)

Catalog#: ARP97316_P050
Domestic: within 24 hours delivery | International: 3-5 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: SILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SMAD3 (ARP97316_P050) antibody is Catalog # AAP97316
Datasheets/Manuals Printable datasheet for anti-SMAD3 (ARP97316_P050) antibody
Gene Symbol SMAD3
Official Gene Full Name SMAD family member 3
Alias Symbols LDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436
NCBI Gene Id 4088
Protein Name Mothers against decapentaplegic homolog 3
Description of Target The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis.
Swissprot Id P84022
Protein Accession # NP_001138574.1
Nucleotide Accession # NM_001145102.1
Protein Size (# AA) 425
Molecular Weight 46 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SMAD3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SMAD3.
  1. What is the species homology for "SMAD3 Antibody - N-terminal region (ARP97316_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "SMAD3 Antibody - N-terminal region (ARP97316_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "SMAD3 Antibody - N-terminal region (ARP97316_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SMAD3 Antibody - N-terminal region (ARP97316_P050)"?

    This target may also be called "LDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436" in publications.

  5. What is the shipping cost for "SMAD3 Antibody - N-terminal region (ARP97316_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SMAD3 Antibody - N-terminal region (ARP97316_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SMAD3 Antibody - N-terminal region (ARP97316_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SMAD3 Antibody - N-terminal region (ARP97316_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SMAD3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SMAD3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SMAD3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SMAD3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SMAD3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SMAD3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SMAD3 Antibody - N-terminal region (ARP97316_P050)
Your Rating