- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for Smad2/3 Antibody (Phospho-Thr8) (OAAF07593) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Product Format | Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Western blot |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human Smad2/3 around the phosphorylation site of Thr8. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE |
Concentration | 1mg/ml |
Target Post-Translational Modification | Phospho Modification Sites: H:T8, M:T8, R:T8 |
Specificity | Smad2/3 (Phospho-Thr8) Antibody detects endogenous levels of Smad2/3 only when phosphorylated at Thr8. |
Application Info | WB: 1:500~1000 ELISA: 1:10000 |
Gene Symbol | SMAD2|SMAD3 |
---|---|
Gene Full Name | SMAD family member 2|SMAD family member 3 |
Alias Symbols | hMAD-2;hMAD-3;hSMAD2;hSMAD3;HSPC193;HsT17436;JV15-2;JV18;JV18-1;LDS1C;LDS3;MAD homolog 2;MAD homolog 3;mad homolog JV15-2;mad protein homolog;MAD, mothers against decapentaplegic homolog 3;mad3;MADH2;MADH3;MADR2;Mad-related protein 2;mother against DPP homolog 2;mothers against decapentaplegic homolog 2;mothers against decapentaplegic homolog 3;mothers against DPP homolog 3;Sma- and Mad-related protein 2;SMA- and MAD-related protein 3;SMAD family member 2;SMAD family member 3;SMAD, mothers against DPP homolog 2;SMAD, mothers against DPP homolog 3. |
NCBI Gene Id | 4087|4088 |
Protein Name | Mothers against decapentaplegic homolog 2|Mothers against decapentaplegic homolog 3 |
Description of Target | Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD2/SMAD4 complex, activates transcription. May act as a tumor suppressor in colorectal carcinoma. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.|Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chemotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator. |
Uniprot ID | P84022|Q15796 |
Molecular Weight | 48 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "Smad2/3 Antibody (Phospho-Thr8) (OAAF07593)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "Smad2/3 Antibody (Phospho-Thr8) (OAAF07593)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "Smad2/3 Antibody (Phospho-Thr8) (OAAF07593)" provided in?
This item is provided in "Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Smad2/3 Antibody (Phospho-Thr8) (OAAF07593)"?
This target may also be called "hMAD-2;hMAD-3;hSMAD2;hSMAD3;HSPC193;HsT17436;JV15-2;JV18;JV18-1;LDS1C;LDS3;MAD homolog 2;MAD homolog 3;mad homolog JV15-2;mad protein homolog;MAD, mothers against decapentaplegic homolog 3;mad3;MADH2;MADH3;MADR2;Mad-related protein 2;mother against DPP homolog 2;mothers against decapentaplegic homolog 2;mothers against decapentaplegic homolog 3;mothers against DPP homolog 3;Sma- and Mad-related protein 2;SMA- and MAD-related protein 3;SMAD family member 2;SMAD family member 3;SMAD, mothers against DPP homolog 2;SMAD, mothers against DPP homolog 3." in publications.
-
What is the shipping cost for "Smad2/3 Antibody (Phospho-Thr8) (OAAF07593)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "Smad2/3 Antibody (Phospho-Thr8) (OAAF07593)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Smad2/3 Antibody (Phospho-Thr8) (OAAF07593)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "48 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Smad2/3 Antibody (Phospho-Thr8) (OAAF07593)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SMAD2|SMAD3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SMAD2|SMAD3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SMAD2|SMAD3"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SMAD2|SMAD3"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SMAD2|SMAD3"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SMAD2|SMAD3"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.