Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SLIT3 antibody - N-terminal region : FITC (ARP58766_P050-FITC)

100 ul
$319.00
In Stock

Conjugation Options

ARP58766_P050 Unconjugated

ARP58766_P050-HRP Conjugated

ARP58766_P050-Biotin Conjugated

Gene Symbol:
SLIT3
NCBI Gene Id:
6586
Official Gene Full Name:
Slit homolog 3 (Drosophila)
Protein Name:
Slit homolog 3 protein
Swissprot Id:
O75094
Protein Accession #:
NP_003053
Nucleotide Accession #:
NM_003062
Alias Symbols:
FLJ10764, MEGF5, SLIL2, SLIT1, Slit-3, slit2
Replacement Item:
This antibody may replace item sc-16624 from Santa Cruz Biotechnology.
Description of Target:
SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.
Protein Size (# AA):
1523
Molecular Weight:
168kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLIT3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLIT3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SLIT3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-SLIT3 (ARP58766_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
CAPN1; ROBO2;
Blocking Peptide:
For anti-SLIT3 (ARP58766_P050-FITC) antibody is Catalog # AAP58766 (Previous Catalog # AAPP38647)
Datasheets/Manuals:
Printable datasheet for anti-SLIT3 (ARP58766_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Lin,L. (2006) Stem Cells 24 (11), 2504-2513

Tell us what you think about this item!

Write A Review
    Please, wait...