Size:100 ul
$319.00
In Stock
SKU
ARP58766_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58766_P050 Unconjugated

ARP58766_P050-HRP Conjugated

ARP58766_P050-Biotin Conjugated

SLIT3 Antibody - N-terminal region : FITC (ARP58766_P050-FITC)

Catalog#: ARP58766_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-16624 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLIT3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology dataAnti-SLIT3 (ARP58766_P050)
Peptide SequenceSynthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLIT3 (ARP58766_P050-FITC) antibody is Catalog # AAP58766 (Previous Catalog # AAPP38647)
Datasheets/ManualsPrintable datasheet for anti-SLIT3 (ARP58766_P050-FITC) antibody
Target ReferenceLin,L. (2006) Stem Cells 24 (11), 2504-2513
Gene SymbolSLIT3
Official Gene Full NameSlit homolog 3 (Drosophila)
Alias SymbolsFLJ10764, MEGF5, SLIL2, SLIT1, Slit-3, slit2
NCBI Gene Id6586
Protein NameSlit homolog 3 protein
Description of TargetSLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.
Swissprot IdO75094
Protein Accession #NP_003053
Nucleotide Accession #NM_003062
Protein Size (# AA)1523
Molecular Weight168kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SLIT3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SLIT3.
Protein InteractionsCAPN1; ROBO2;
Write Your Own Review
You're reviewing:SLIT3 Antibody - N-terminal region : FITC (ARP58766_P050-FITC)
Your Rating
Aviva Tips and Tricks
Aviva Tissue Tool
Aviva Pathways
Aviva Travel Grant