Search Antibody, Protein, and ELISA Kit Solutions

SLIT3 antibody - N-terminal region (ARP58766_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58766_P050-FITC Conjugated

ARP58766_P050-HRP Conjugated

ARP58766_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Slit homolog 3 (Drosophila)
Protein Name:
Slit homolog 3 protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ10764, MEGF5, SLIL2, SLIT1, Slit-3, slit2
Replacement Item:
This antibody may replace item sc-16624 from Santa Cruz Biotechnology.
Description of Target:
SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLIT3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLIT3.
The immunogen is a synthetic peptide directed towards the N terminal region of human SLIT3
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-SLIT3 (ARP58766_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SLIT3 (ARP58766_P050) antibody is Catalog # AAP58766 (Previous Catalog # AAPP38647)
Printable datasheet for anti-SLIT3 (ARP58766_P050) antibody
Target Reference:
Lin,L. (2006) Stem Cells 24 (11), 2504-2513

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...