Size:100 ul
$319.00
In Stock
SKU
ARP58766_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58766_P050-FITC Conjugated

ARP58766_P050-HRP Conjugated

ARP58766_P050-Biotin Conjugated

SLIT3 Antibody - N-terminal region (ARP58766_P050)

Catalog#: ARP58766_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-16624 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLIT3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology dataAnti-SLIT3 (ARP58766_P050)
Peptide SequenceSynthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-SLIT3 (ARP58766_P050) antibody is Catalog # AAP58766 (Previous Catalog # AAPP38647)
Datasheets/ManualsPrintable datasheet for anti-SLIT3 (ARP58766_P050) antibody
Target ReferenceLin,L. (2006) Stem Cells 24 (11), 2504-2513
Gene SymbolSLIT3
Official Gene Full NameSlit homolog 3 (Drosophila)
Alias SymbolsFLJ10764, MEGF5, SLIL2, SLIT1, Slit-3, slit2
NCBI Gene Id6586
Protein NameSlit homolog 3 protein
Description of TargetSLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.
Swissprot IdO75094
Protein Accession #NP_003053
Nucleotide Accession #NM_003062
Protein Size (# AA)1523
Molecular Weight168kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SLIT3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SLIT3.
Protein InteractionsCAPN1; ROBO2;
Write Your Own Review
You're reviewing:SLIT3 Antibody - N-terminal region (ARP58766_P050)
Your Rating
Aviva Blast Tool
Aviva Tissue Tool
Aviva HIS tag Deal
Aviva ChIP Antibodies