Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP58765_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58765_P050-FITC Conjugated

ARP58765_P050-HRP Conjugated

ARP58765_P050-Biotin Conjugated

SLIT1 Antibody - middle region (ARP58765_P050)

Catalog#: ARP58765_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-16616 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLIT1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 86%
Complete computational species homology dataAnti-SLIT1 (ARP58765_P050)
Peptide SequenceSynthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-SLIT1 (ARP58765_P050) antibody is Catalog # AAP58765 (Previous Catalog # AAPP38532)
Datasheets/ManualsPrintable datasheet for anti-SLIT1 (ARP58765_P050) antibody
Target ReferenceHussain,S.A., (2006) J. Biol. Chem. 281 (51), 39693-39698
Gene SymbolSLIT1
Official Gene Full NameSlit homolog 1 (Drosophila)
Alias SymbolsMEGF4, SLIL1, SLIT3, Slit-1, SLIT-1
NCBI Gene Id6585
Protein NameSlit homolog 1 protein
Description of TargetSLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors. During neural development involved in axonal navigation at the ventral midline of the neural tub
Swissprot IdO75093
Protein Accession #NP_003052
Nucleotide Accession #NM_003061
Protein Size (# AA)1534
Molecular Weight168kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SLIT1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SLIT1.
Protein InteractionsATN1; ROBO1; GPC1;
Write Your Own Review
You're reviewing:SLIT1 Antibody - middle region (ARP58765_P050)
Your Rating
Aviva Tissue Tool
Aviva HIS tag Deal
Aviva Travel Grant
Assay Development