SLIT1 Antibody - middle region (ARP58765_P050)

Catalog No: ARP58765_P050

WB Suggested Anti-SLIT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Stomach

Immunohistochemistry with SLIT1 GFP/ WT mouse gut tissue at an antibody concentration of 2.5 ug/ml using anti-SLIT1 antibody (ARP58765_P050)

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLIT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLIT1 (ARP58765_P050) antibody is Catalog # AAP58765 (Previous Catalog # AAPP38532)
• Reference: Hussain,S.A., (2006) J. Biol. Chem. 281 (51), 39693-39698

Target Info

• Gene Symbol: SLIT1
• Gene Full Name: Slit homolog 1 (Drosophila)
• Alias Symbols: MEGF4, SLIL1, SLIT3, SLIT-1
• NCBI Gene Id: 6585
• Protein Name: Slit homolog 1 protein
• Description of Target: SLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors. During neural development involved in axonal navigation at the ventral midline of the neural tub
• Uniprot ID: O75093
• Protein Accession #: NP_003052
• Nucleotide Accession #: NM_003061
• Protein Size (# AA): 1534
• Molecular Weight: 168kDa
• Protein Interactions: ATN1; ROBO1; GPC1;