Search Antibody, Protein, and ELISA Kit Solutions

SLCO4A1 Antibody - middle region (ARP85243_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
The immunogen is a synthetic peptide directed towards the middle region of human SLCO4A1
Peptide Sequence:
Synthetic peptide located within the following region: WWVGFLGSGAAAFFTAVPILGYPRQLPGSQRYAVMRAAEMHQLKDSSRGE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SLCO4A1 (ARP85243_P050) antibody is Catalog # AAP85243
Printable datasheet for anti-SLCO4A1 (ARP85243_P050) antibody
Gene Symbol:
Official Gene Full Name:
solute carrier organic anion transporter family member 4A1
Alias Symbols:
NCBI Gene Id:
Protein Name:
solute carrier organic anion transporter family member 4A1
Description of Target:
Mediates the Na+-independent transport of organic anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and of estrone-3-sulfate and taurocholate.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
79 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLCO4A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLCO4A1.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...