Size:100 ul
$319.00
In Stock
SKU
ARP43926_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43926_P050-FITC Conjugated

ARP43926_P050-HRP Conjugated

ARP43926_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-66561 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO2B1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-SLCO2B1 (ARP43926_P050)
Peptide Sequence Synthetic peptide located within the following region: DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SLCO2B1 (ARP43926_P050) antibody is Catalog # AAP43926 (Previous Catalog # AAPP25461)
Datasheets/Manuals Printable datasheet for anti-SLCO2B1 (ARP43926_P050) antibody
Sample Type Confirmation

SLCO2B1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Miura,M., (2007) Eur. J. Clin. Pharmacol. 63 (12), 1161-1169
Gene Symbol SLCO2B1
Official Gene Full Name Solute carrier organic anion transporter family, member 2B1
Alias Symbols DKFZp686E0517, KIAA0880, OATP-B, OATP2B1, OATPB, SLC21A9
NCBI Gene Id 11309
Protein Name Solute carrier organic anion transporter family member 2B1
Description of Target SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.
Swissprot Id O94956
Protein Accession # NP_009187
Nucleotide Accession # NM_007256
Protein Size (# AA) 709
Molecular Weight 77kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SLCO2B1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SLCO2B1.
Protein Interactions APP;
  1. What is the species homology for "SLCO2B1 Antibody - N-terminal region (ARP43926_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "SLCO2B1 Antibody - N-terminal region (ARP43926_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLCO2B1 Antibody - N-terminal region (ARP43926_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLCO2B1 Antibody - N-terminal region (ARP43926_P050)"?

    This target may also be called "DKFZp686E0517, KIAA0880, OATP-B, OATP2B1, OATPB, SLC21A9" in publications.

  5. What is the shipping cost for "SLCO2B1 Antibody - N-terminal region (ARP43926_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLCO2B1 Antibody - N-terminal region (ARP43926_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLCO2B1 Antibody - N-terminal region (ARP43926_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "77kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLCO2B1 Antibody - N-terminal region (ARP43926_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SLCO2B1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLCO2B1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLCO2B1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLCO2B1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLCO2B1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLCO2B1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLCO2B1 Antibody - N-terminal region (ARP43926_P050)
Your Rating
We found other products you might like!