Search Antibody, Protein, and ELISA Kit Solutions

SLCO2B1 Antibody - N-terminal region (ARP43926_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43926_P050-FITC Conjugated

ARP43926_P050-HRP Conjugated

ARP43926_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-66561 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO2B1
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-SLCO2B1 (ARP43926_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SLCO2B1 (ARP43926_P050) antibody is Catalog # AAP43926 (Previous Catalog # AAPP25461)
Printable datasheet for anti-SLCO2B1 (ARP43926_P050) antibody
Sample Type Confirmation:

SLCO2B1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Miura,M., (2007) Eur. J. Clin. Pharmacol. 63 (12), 1161-1169
Gene Symbol:
Official Gene Full Name:
Solute carrier organic anion transporter family, member 2B1
Alias Symbols:
DKFZp686E0517, KIAA0880, OATP-B, OATP2B1, OATPB, SLC21A9
NCBI Gene Id:
Protein Name:
Solute carrier organic anion transporter family member 2B1
Description of Target:
SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLCO2B1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLCO2B1.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...