Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SLCO1A2 antibody - middle region (ARP43899_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock

Conjugation Options

ARP43899_P050-FITC Conjugated

ARP43899_P050-HRP Conjugated

ARP43899_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
SLCO1A2
NCBI Gene Id:
6579
Official Gene Full Name:
Solute carrier organic anion transporter family, member 1A2
Protein Name:
Solute carrier organic anion transporter family member 1A2
Swissprot Id:
P46721-2
Protein Accession #:
AAD52694
Nucleotide Accession #:
NM_021094
Alias Symbols:
OATP, OATP-A, OATP1A2, SLC21A3
Description of Target:
SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.
Protein Size (# AA):
579
Molecular Weight:
64kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLCO1A2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLCO1A2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SLCO1A2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 93%
Complete computational species homology data:
Anti-SLCO1A2 (ARP43899_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PDZD3; SLC9A3R2; SLC9A3R1; PDZK1;
Blocking Peptide:
For anti-SLCO1A2 (ARP43899_P050) antibody is Catalog # AAP43899 (Previous Catalog # AAPP11702)
Datasheets/Manuals:
Printable datasheet for anti-SLCO1A2 (ARP43899_P050) antibody
Sample Type Confirmation:

SLCO1A2 is strongly supported by BioGPS gene expression data to be expressed in PANC1

Conjugation:
Unconjugated

Tell us what you think about this item!

Write A Review
    Please, wait...