SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP43890_P050
Price: $0.00
SKU
ARP43890_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Slc9a3r2 Antibody - C-terminal region (ARP43890_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-Slc9a3r2 (ARP43890_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: HFKRLRVIPTEEHVEGPLPSPVTNGTSPAQLNGGSVCSSRSDLPGSEKDN
Concentration0.5 mg/ml
Blocking PeptideFor anti-Slc9a3r2 (ARP43890_P050) antibody is Catalog # AAP43890
Gene SymbolSlc9a3r2
Gene Full NameSolute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2
Alias SymbolsS, Si, Sr, E3k, Oct, Nher, Sip1, Tka-, Octs2, Sip-1, Tka-1, E3karp, Nherf2, Sryip1, NHERF-2, 0610011L07Rik, 1200011K07Rik, 2010007A20Rik
NCBI Gene Id65962
Protein NameNa(+)/H(+) exchange regulatory cofactor NHE-RF2
Description of TargetSlc9a3r2 is a scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. It is necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. It may also act as scaffold protein in the nucleus.
Uniprot IDQ9JHL1-2
Protein Accession #NP_075938
Nucleotide Accession #NM_023449
Protein Size (# AA)226
Molecular Weight25kDa
Protein InteractionsSlc34a1; Trpv5;
  1. What is the species homology for "Slc9a3r2 Antibody - C-terminal region (ARP43890_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "Slc9a3r2 Antibody - C-terminal region (ARP43890_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Slc9a3r2 Antibody - C-terminal region (ARP43890_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Slc9a3r2 Antibody - C-terminal region (ARP43890_P050)"?

    This target may also be called "S, Si, Sr, E3k, Oct, Nher, Sip1, Tka-, Octs2, Sip-1, Tka-1, E3karp, Nherf2, Sryip1, NHERF-2, 0610011L07Rik, 1200011K07Rik, 2010007A20Rik" in publications.

  5. What is the shipping cost for "Slc9a3r2 Antibody - C-terminal region (ARP43890_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Slc9a3r2 Antibody - C-terminal region (ARP43890_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Slc9a3r2 Antibody - C-terminal region (ARP43890_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Slc9a3r2 Antibody - C-terminal region (ARP43890_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC9A3R2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC9A3R2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC9A3R2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC9A3R2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC9A3R2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC9A3R2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Slc9a3r2 Antibody - C-terminal region (ARP43890_P050)
Your Rating