- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
SLC7A5 Antibody - N-terminal region (ARP63651_P050)
Datasheets/Manuals | Printable datasheet for anti-SLC7A5 (ARP63651_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Human: 100% |
Peptide Sequence | Synthetic peptide located within the following region: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SLC7A5 (ARP63651_P050) antibody is Catalog # AAP63651 |
Sample Type Confirmation | SLC7A5 is supported by BioGPS gene expression data to be expressed in 721_B, HeLa, HepG2 |
Subunit | 1 |
Gene Symbol | SLC7A5 |
---|---|
Gene Full Name | Solute carrier family 7 (amino acid transporter light chain, L system), member 5 |
Alias Symbols | E16, CD98, LAT1, 4F2LC, MPE16, D16S469E |
NCBI Gene Id | 8140 |
Protein Name | Large neutral amino acids transporter small subunit 1 |
Description of Target | SLC7A5 is a sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. SLC7A5 is involved in cellular amino acid uptake. SLC7A5 acts as an amino acid exchanger. SLC7A5 is involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. SLC7A5 plays a role in neuronal cell proliferation (neurogenesis) in brain. SLC7A5 is involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. SLC7A5 is involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. SLC7A5 may play an important role in high-grade gliomas. SLC7A5 mediates blood-to-retina L-leucine transport across the inner blood-retinal barrier which in turn may play a key role in maintaining large neutral amino acids as well as neurotransmitters in the neural retina. SLC7A5 acts as the major transporter of tyrosine in fibroblasts. |
Uniprot ID | Q01650 |
Protein Accession # | NP_003477 |
Nucleotide Accession # | NM_003486 |
Protein Size (# AA) | 507 |
Molecular Weight | 56kDa |
Protein Interactions | UBC; SUMO2; LGR4; NOS2; HNRNPU; ELAVL1; SLC3A2; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "SLC7A5 Antibody - N-terminal region (ARP63651_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?
This target may also be called "E16, CD98, LAT1, 4F2LC, MPE16, D16S469E" in publications.
-
What is the shipping cost for "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "56kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SLC7A5 Antibody - N-terminal region (ARP63651_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SLC7A5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SLC7A5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SLC7A5"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SLC7A5"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SLC7A5"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SLC7A5"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.