Catalog No: ARP43766_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SLC7A2 (ARP43766_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC7A2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC7A2 (ARP43766_P050) antibody is Catalog # AAP43766 (Previous Catalog # AAPP25355)

Kohlhaas, C. F. et al. Insulin rapidly stimulates L-arginine transport in human aortic endothelial cells via Akt. Biochem. Biophys. Res. Commun. 412, 747-51 (2011). 21871446

MCD diet-induced steatohepatitis is associated with alterations in asymmetric dimethylarginine (ADMA) and its transporters. Mol. Cell. Biochem. 419, 147-55 (2016). 27357826

Gene SymbolSLC7A2
Gene Full NameSolute carrier family 7 (cationic amino acid transporter, y+ system), member 2
Alias SymbolsCAT2, ATRC2, HCAT2
NCBI Gene Id6542
Protein NameLow affinity cationic amino acid transporter 2
Description of TargetSLC7A2 is a low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). SLC7A2 plays a regulatory role in classical or alternative activation of macrophages.
Uniprot IDP52569
Protein Accession #NP_001008539
Nucleotide Accession #NM_001008539
Protein Size (# AA)658
Molecular Weight72kDa
Protein InteractionsUBC;
  1. What is the species homology for "SLC7A2 Antibody - middle region (ARP43766_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "SLC7A2 Antibody - middle region (ARP43766_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC7A2 Antibody - middle region (ARP43766_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC7A2 Antibody - middle region (ARP43766_P050)"?

    This target may also be called "CAT2, ATRC2, HCAT2" in publications.

  5. What is the shipping cost for "SLC7A2 Antibody - middle region (ARP43766_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC7A2 Antibody - middle region (ARP43766_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC7A2 Antibody - middle region (ARP43766_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "72kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC7A2 Antibody - middle region (ARP43766_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC7A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC7A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC7A2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC7A2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC7A2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC7A2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC7A2 Antibody - middle region (ARP43766_P050)
Your Rating
We found other products you might like!