Size:100 ul
$319.00
In stock
SKU
ARP43766_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43766_P050-FITC Conjugated

ARP43766_P050-HRP Conjugated

ARP43766_P050-Biotin Conjugated

SLC7A2 Antibody - middle region (ARP43766_P050)

Catalog#: ARP43766_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-142025 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SLC7A2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-SLC7A2 (ARP43766_P050)
Peptide Sequence Synthetic peptide located within the following region: VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SLC7A2 (ARP43766_P050) antibody is Catalog # AAP43766 (Previous Catalog # AAPP25355)
Datasheets/Manuals Printable datasheet for anti-SLC7A2 (ARP43766_P050) antibody
Publications

Di Pasqua, LG; Berardo, C; Rizzo, V; Richelmi, P; Croce, AC; Vairetti, M; Ferrigno, A; MCD diet-induced steatohepatitis is associated with alterations in asymmetric dimethylarginine (ADMA) and its transporters. 419, 147-55 (2016). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 27357826

Kohlhaas, C. F. et al. Insulin rapidly stimulates L-arginine transport in human aortic endothelial cells via Akt. Biochem. Biophys. Res. Commun. 412, 747-51 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 21871446

Gene Symbol SLC7A2
Official Gene Full Name Solute carrier family 7 (cationic amino acid transporter, y+ system), member 2
Alias Symbols ATRC2, CAT-2, HCAT2, CAT2
NCBI Gene Id 6542
Protein Name Low affinity cationic amino acid transporter 2
Description of Target SLC7A2 is a low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). SLC7A2 plays a regulatory role in classical or alternative activation of macrophages.
Swissprot Id P52569
Protein Accession # NP_001008539
Nucleotide Accession # NM_001008539
Protein Size (# AA) 658
Molecular Weight 72kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SLC7A2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SLC7A2.
Protein Interactions UBC;
Write Your Own Review
You're reviewing:SLC7A2 Antibody - middle region (ARP43766_P050)
Your Rating