Search Antibody, Protein, and ELISA Kit Solutions

SLC7A2 antibody - middle region (ARP43766_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43766_P050-FITC Conjugated

ARP43766_P050-HRP Conjugated

ARP43766_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Solute carrier family 7 (cationic amino acid transporter, y+ system), member 2
Protein Name:
Low affinity cationic amino acid transporter 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-142025 from Santa Cruz Biotechnology.
Description of Target:
SLC7A2 is a low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). SLC7A2 plays a regulatory role in classical or alternative activation of macrophages.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC7A2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC7A2.
The immunogen is a synthetic peptide directed towards the middle region of human SLC7A2
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-SLC7A2 (ARP43766_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SLC7A2 (ARP43766_P050) antibody is Catalog # AAP43766 (Previous Catalog # AAPP25355)
Printable datasheet for anti-SLC7A2 (ARP43766_P050) antibody

Di Pasqua, LG; Berardo, C; Rizzo, V; Richelmi, P; Croce, AC; Vairetti, M; Ferrigno, A; MCD diet-induced steatohepatitis is associated with alterations in asymmetric dimethylarginine (ADMA) and its transporters. 419, 147-55 (2016). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 27357826

Kohlhaas, C. F. et al. Insulin rapidly stimulates L-arginine transport in human aortic endothelial cells via Akt. Biochem. Biophys. Res. Commun. 412, 747-51 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 21871446

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...