SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP43791_P050
Price: $0.00
SKU
ARP43791_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

SLC6A3 Antibody - N-terminal region (ARP43791_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-SLC6A3 (ARP43791_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC6A3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC6A3 (ARP43791_P050) antibody is Catalog # AAP43791 (Previous Catalog # AAPP25380)
Gene SymbolSLC6A3
Gene Full NameSolute carrier family 6 (neurotransmitter transporter, dopamine), member 3
Alias SymbolsDAT, DAT1, PKDYS, PKDYS1
NCBI Gene Id6531
Protein NameSodium-dependent dopamine transporter
Description of TargetThis gene encodes a dopamine transporter which is a member of the sodium- and chloride-dependent neurotransmitter transporter family. The 3' UTR of this gene contains a 40 bp tandem repeat, referred to as a variable number tandem repeat or VNTR, which can be present in 3 to 11 copies. Variation in the number of repeats is associated with idiopathic epilepsy, attention-deficit hyperactivity disorder, dependence on alcohol and cocaine, susceptibility to Parkinson disease and protection against nicotine dependence.
Uniprot IDQ01959
Protein Accession #NP_001035
Nucleotide Accession #NM_001044
Protein Size (# AA)620
Molecular Weight68kDa
Protein InteractionsSNTA1; TUBB1; TUBA1B; SNCA; CAMK2A; STX1A; NEDD4; UBC; PARK2; EPS15; EPN1; PICK1; TGFB1I1; GNB2L1; SLC6A3; DRD2;
  1. What is the species homology for "SLC6A3 Antibody - N-terminal region (ARP43791_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "SLC6A3 Antibody - N-terminal region (ARP43791_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC6A3 Antibody - N-terminal region (ARP43791_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC6A3 Antibody - N-terminal region (ARP43791_P050)"?

    This target may also be called "DAT, DAT1, PKDYS, PKDYS1" in publications.

  5. What is the shipping cost for "SLC6A3 Antibody - N-terminal region (ARP43791_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC6A3 Antibody - N-terminal region (ARP43791_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC6A3 Antibody - N-terminal region (ARP43791_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "68kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC6A3 Antibody - N-terminal region (ARP43791_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC6A3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC6A3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC6A3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC6A3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC6A3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC6A3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC6A3 Antibody - N-terminal region (ARP43791_P050)
Your Rating
We found other products you might like!