Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP44110_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP44110_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

SLC5A8 Antibody - middle region : Biotin (ARP44110_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-SLC5A8 (ARP44110_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC5A8
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Mouse: 83%; Rabbit: 92%; Rat: 91%
Peptide SequenceSynthetic peptide located within the following region: GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC5A8 (ARP44110_P050-Biotin) antibody is Catalog # AAP44110 (Previous Catalog # AAPP25556)
Publications

Zhang, Y. et al. Activin A induces SLC5A8 expression through the Smad3 signaling pathway in human colon cancer RKO cells. Int. J. Biochem. Cell Biol. 42, 1964-72 (2010). WB, Human, Rabbit, Rat, Mouse 20732443

Babu, E. et al. Role of SLC5A8, a plasma membrane transporter and a tumor suppressor, in the antitumor activity of dichloroacetate. Oncogene 30, 4026-37 (2011). WB, Human, Rabbit, Rat, Mouse 21499304

Elangovan, S. et al. Molecular mechanism of SLC5A8 inactivation in breast cancer. Mol. Cell. Biol. 33, 3920-35 (2013). WB, Human, Rabbit, Rat, Mouse 23918800

Gene SymbolSLC5A8
Gene Full NameSolute carrier family 5 (iodide transporter), member 8
Alias SymbolsAIT, SMCT, SMCT1
NCBI Gene Id160728
Protein NameSodium-coupled monocarboxylate transporter 1
Description of TargetSLC5A8 has been shown to transport iodide by a passive mechanism (Rodriguez et al., 2002 [PubMed 12107270]) and monocarboxylates and short-chain fatty acids by a sodium-coupled mechanism (Gopal et al., 2004 [PubMed 15322102]). In kidney, SLC5A8 functions
Uniprot IDQ8N695
Protein Accession #NP_666018
Nucleotide Accession #NM_145913
Protein Size (# AA)610
Molecular Weight66kDa
  1. What is the species homology for "SLC5A8 Antibody - middle region : Biotin (ARP44110_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Rabbit".

  2. How long will it take to receive "SLC5A8 Antibody - middle region : Biotin (ARP44110_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC5A8 Antibody - middle region : Biotin (ARP44110_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC5A8 Antibody - middle region : Biotin (ARP44110_P050-Biotin)"?

    This target may also be called "AIT, SMCT, SMCT1" in publications.

  5. What is the shipping cost for "SLC5A8 Antibody - middle region : Biotin (ARP44110_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC5A8 Antibody - middle region : Biotin (ARP44110_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC5A8 Antibody - middle region : Biotin (ARP44110_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "66kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC5A8 Antibody - middle region : Biotin (ARP44110_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC5A8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC5A8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC5A8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC5A8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC5A8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC5A8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC5A8 Antibody - middle region : Biotin (ARP44110_P050-Biotin)
Your Rating
We found other products you might like!