Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SLC5A8 antibody - middle region (ARP44110_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP44110_P050-FITC Conjugated

ARP44110_P050-HRP Conjugated

ARP44110_P050-Biotin Conjugated

Gene Symbol:
SLC5A8
NCBI Gene Id:
160728
Official Gene Full Name:
Solute carrier family 5 (iodide transporter), member 8
Protein Name:
Sodium-coupled monocarboxylate transporter 1
Swissprot Id:
Q8N695
Protein Accession #:
NP_666018
Nucleotide Accession #:
NM_145913
Alias Symbols:
AIT, MGC125354, SMCT, SMCT1
Replacement Item:
This antibody may replace item sc-34188 from Santa Cruz Biotechnology.
Description of Target:
SLC5A8 has been shown to transport iodide by a passive mechanism (Rodriguez et al., 2002 [PubMed 12107270]) and monocarboxylates and short-chain fatty acids by a sodium-coupled mechanism (Gopal et al., 2004 [PubMed 15322102]). In kidney, SLC5A8 functions
Protein Size (# AA):
610
Molecular Weight:
66kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC5A8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC5A8.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SLC5A8
Species Reactivity:
Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 83%; Rabbit: 92%; Rat: 91%
Complete computational species homology data:
Anti-SLC5A8 (ARP44110_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SLC5A8 (ARP44110_P050) antibody is Catalog # AAP44110 (Previous Catalog # AAPP25556)
Datasheets/Manuals:
Printable datasheet for anti-SLC5A8 (ARP44110_P050) antibody
Publications:

Zhang, Y. et al. Activin A induces SLC5A8 expression through the Smad3 signaling pathway in human colon cancer RKO cells. Int. J. Biochem. Cell Biol. 42, 1964-72 (2010). WB, Human, Mouse, Rabbit, Rat 20732443

Babu, E. et al. Role of SLC5A8, a plasma membrane transporter and a tumor suppressor, in the antitumor activity of dichloroacetate. Oncogene 30, 4026-37 (2011). WB, Human, Mouse, Rabbit, Rat 21499304

Elangovan, S. et al. Molecular mechanism of SLC5A8 inactivation in breast cancer. Mol. Cell. Biol. 33, 3920-35 (2013). WB, Human, Mouse, Rabbit, Rat 23918800

Tell us what you think about this item!

Write A Review
    Please, wait...