SLC5A8 Antibody - middle region (ARP44110_P050)

Catalog No: ARP44110_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. Protein is glycosylated as well.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC5A8
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 83%; Rabbit: 92%; Rat: 91%
• Peptide Sequence: Synthetic peptide located within the following region: GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLC5A8 (ARP44110_P050) antibody is Catalog # AAP44110 (Previous Catalog # AAPP25556)
• Enhanced Validation:

  Relative Expression (Western Blot)
  SPR Affinity Characterization

• Publications:

  Babu, E. et al. Role of SLC5A8, a plasma membrane transporter and a tumor suppressor, in the antitumor activity of dichloroacetate. Oncogene 30, 4026-37 (2011). 21499304

  Elangovan, S. et al. Molecular mechanism of SLC5A8 inactivation in breast cancer. Mol. Cell. Biol. 33, 3920-35 (2013). 23918800

  Zhang, Y. et al. Activin A induces SLC5A8 expression through the Smad3 signaling pathway in human colon cancer RKO cells. Int. J. Biochem. Cell Biol. 42, 1964-72 (2010). 20732443

Target Info

• Gene Symbol: SLC5A8
• Gene Full Name: Solute carrier family 5 (iodide transporter), member 8
• Alias Symbols: AIT, SMCT, SMCT1
• NCBI Gene Id: 160728
• Protein Name: Sodium-coupled monocarboxylate transporter 1
• Description of Target: SLC5A8 has been shown to transport iodide by a passive mechanism (Rodriguez et al., 2002 [PubMed 12107270]) and monocarboxylates and short-chain fatty acids by a sodium-coupled mechanism (Gopal et al., 2004 [PubMed 15322102]). In kidney, SLC5A8 functions
• Uniprot ID: Q8N695
• Protein Accession #: NP_666018
• Nucleotide Accession #: NM_145913
• Protein Size (# AA): 610
• Molecular Weight: 66 kDa