Search Antibody, Protein, and ELISA Kit Solutions

SLC5A5 Antibody - N-terminal region (ARP43751_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43751_P050-FITC Conjugated

ARP43751_P050-HRP Conjugated

ARP43751_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
SLC5A5
Official Gene Full Name:
Solute carrier family 5 (sodium iodide symporter), member 5
NCBI Gene Id:
6528
Protein Name:
Sodium/iodide cotransporter
Swissprot Id:
Q92911
Protein Accession #:
NP_000444
Nucleotide Accession #:
NM_000453
Alias Symbols:
NIS, TDH1
Replacement Item:
This antibody may replace item sc-34189 from Santa Cruz Biotechnology.
Description of Target:
The sodium-iodide symporter (NIS, or SLC5A5) is a key plasma membrane protein that mediates active I- uptake in thyroid, lactating breast, and other tissues with an electrogenic stoichiometry of 2 Na+ per I-. In thyroid, NIS-mediated I- uptake is the first step in the biosynthesis of iodine-containing thyroid hormones.
Protein Size (# AA):
643
Molecular Weight:
69kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC5A5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC5A5.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC5A5
Predicted Homology Based on Immunogen Sequence:
Horse: 79%; Human: 100%; Mouse: 79%; Rat: 93%
Complete computational species homology data:
Anti-SLC5A5 (ARP43751_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ERBB2IP; SLC5A5;
Blocking Peptide:
For anti-SLC5A5 (ARP43751_P050) antibody is Catalog # AAP43751 (Previous Catalog # AAPP25341)
Datasheets/Manuals:
Printable datasheet for anti-SLC5A5 (ARP43751_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...