Search Antibody, Protein, and ELISA Kit Solutions

SLC4A8 Antibody - N-terminal region (ARP85341_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
SLC4A8
Official Gene Full Name:
solute carrier family 4, sodium bicarbonate cotransporter, member 8
NCBI Gene Id:
9498
Protein Name:
electroneutral sodium bicarbonate exchanger 1
Swissprot Id:
Q2Y0W8-7
Protein Accession #:
NP_001035049.1
Nucleotide Accession #:
NM_001039960.2
Alias Symbols:
NBC3, NDCBE
Description of Target:
The protein encoded by this gene is a membrane protein that functions to transport sodium and bicarbonate ions across the cell membrane. The encoded protein is important for pH regulation in neurons. The activity of this protein can be inhibited by 4,4'-Di-isothiocyanatostilbene-2,2'-disulfonic acid (DIDS). Several transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
747
Molecular Weight:
82 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC4A8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC4A8.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC4A8
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEALAHDTPSQRVQFILGT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SLC4A8 (ARP85341_P050) antibody is Catalog # AAP85341
Datasheets/Manuals:
Printable datasheet for anti-SLC4A8 (ARP85341_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...