Search Antibody, Protein, and ELISA Kit Solutions

SLC39A6 Antibody - middle region (ARP43931_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43931_T100-FITC Conjugated

ARP43931_T100-HRP Conjugated

ARP43931_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Solute carrier family 39 (zinc transporter), member 6
NCBI Gene Id:
Protein Name:
Zinc transporter ZIP6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-133741 from Santa Cruz Biotechnology.
Description of Target:
Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC39A6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC39A6.
The immunogen is a synthetic peptide directed towards the middle region of human SLC39A6
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-SLC39A6 (ARP43931_T100)
Peptide Sequence:
Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SLC39A6 (ARP43931_T100) antibody is Catalog # AAP43931 (Previous Catalog # AAPP25466)
Printable datasheet for anti-SLC39A6 (ARP43931_T100) antibody
Sample Type Confirmation:

SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HEK293T, MCF7


Trokovic, N. et al. Exosomal secretion of death bullets: a new way of apoptotic escape? Am. J. Physiol. Endocrinol. Metab. 303, E1015-24 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 22912365

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...