Catalog No: ARP53259_P050
Price: $0.00
SKU
ARP53259_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SLC38A9 (ARP53259_P050) antibody
Product Info
Publications

Pulsatile delivery of a leucine supplement during long-term continuous enteral feeding enhances lean growth in term neonatal pigs. Am J Physiol Endocrinol Metab. 2016 Apr 15 310(8): E699-E713. 26884386

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC38A9
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 86%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: VLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNS
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC38A9 (ARP53259_P050) antibody is Catalog # AAP53259 (Previous Catalog # AAPP30742)
ReferenceOtsuki,T., (2005) DNA Res. 12 (2), 117-126
Gene SymbolSLC38A9
Gene Full NameSolute carrier family 38, member 9
Alias SymbolsURLC11
NCBI Gene Id153129
Protein NameSodium-coupled neutral amino acid transporter 9
Uniprot IDQ8NBW4
Protein Accession #NP_775785
Nucleotide Accession #NM_173514
Protein Size (# AA)561
Molecular Weight64kDa
Protein InteractionsUBC;
  1. What is the species homology for "SLC38A9 Antibody - middle region (ARP53259_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "SLC38A9 Antibody - middle region (ARP53259_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC38A9 Antibody - middle region (ARP53259_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC38A9 Antibody - middle region (ARP53259_P050)"?

    This target may also be called "URLC11" in publications.

  5. What is the shipping cost for "SLC38A9 Antibody - middle region (ARP53259_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC38A9 Antibody - middle region (ARP53259_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC38A9 Antibody - middle region (ARP53259_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "64kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC38A9 Antibody - middle region (ARP53259_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC38A9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC38A9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC38A9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC38A9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC38A9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC38A9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC38A9 Antibody - middle region (ARP53259_P050)
Your Rating