SLC37A4 Antibody - N-terminal region (ARP43820_P050)

Catalog No: ARP43820_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. .25 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-SLC37A4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Rabbit Anti-SLC37A4 Antibody
Catalog Number: ARP43820_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm in hepatocytes, moderate tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC37A4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: LVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLC37A4 (ARP43820_P050) antibody is Catalog # AAP43820 (Previous Catalog # AAPS14105)
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Fortier,S., (2008) FEBS Lett. 582 (5), 799-804

Target Info

• Gene Symbol: SLC37A4
• Gene Full Name: Solute carrier family 37 (glucose-6-phosphate transporter), member 4
• Alias Symbols: G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d, TRG19, TRG-19, PRO0685
• NCBI Gene Id: 2542
• Protein Name: Glucose-6-phosphate translocase
• Description of Target: SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
• Uniprot ID: O43826
• Protein Accession #: NP_001458
• Nucleotide Accession #: NM_001467
• Protein Size (# AA): 429
• Molecular Weight: 46 kDa
• Protein Interactions: SHBG; UBC;