Search Antibody, Protein, and ELISA Kit Solutions

SLC37A4 Antibody - middle region (ARP43821_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43821_P050-FITC Conjugated

ARP43821_P050-HRP Conjugated

ARP43821_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Solute carrier family 37 (glucose-6-phosphate transporter), member 4
NCBI Gene Id:
Protein Name:
Glucose-6-phosphate translocase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d, MGC15729, PRO0685, TRG19, TRG-19
Replacement Item:
This antibody may replace item sc-116933 from Santa Cruz Biotechnology.
Description of Target:
SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC37A4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC37A4.
The immunogen is a synthetic peptide directed towards the middle region of human SLC37A4
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-SLC37A4 (ARP43821_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SLC37A4 (ARP43821_P050) antibody is Catalog # AAP43821 (Previous Catalog # AAPS14106)
Printable datasheet for anti-SLC37A4 (ARP43821_P050) antibody
Sample Type Confirmation:

SLC37A4 is supported by BioGPS gene expression data to be expressed in OVCAR3

Target Reference:
Fortier,S., (2008) FEBS Lett. 582 (5), 799-804

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...