Search Antibody, Protein, and ELISA Kit Solutions

SLC35D1 Antibody - C-terminal region : FITC (ARP74231_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74231_P050 Unconjugated

ARP74231_P050-HRP Conjugated

ARP74231_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
solute carrier family 35 member D1
NCBI Gene Id:
Protein Name:
UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter
Swissprot Id:
Protein Accession #:
Alias Symbols:
Description of Target:
Glycosylation of cellular glycoconjugates occurs in the endoplasmic reticulum (ER) and Golgi compartment, and requires transport of nucleotide sugars from the cytosol into the lumen of the ER and Golgi by specific transporters. The protein encoded by this gene resides in the ER, and transports both UDP-glucuronic acid (UDP-GlcA) and UDP-N-acetylgalactosamine (UDP-GalNAc) from the cytoplasm to the ER lumen. It may participate in glucuronidation and/or chondroitin sulfate biosynthesis. Mutations in this gene are associated with Schneckenbecken dysplasia.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC35D1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC35D1.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human S35D1
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: GGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEANNKLDIKGKG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SLC35D1 (ARP74231_P050-FITC) antibody is Catalog # AAP74231
Printable datasheet for anti-SLC35D1 (ARP74231_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...