SLC34A3 Antibody - middle region (ARP32173_P050)

Catalog No: ARP32173_P050

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein is modified by glycosylation.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-SLC34A3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC34A3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 85%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLC34A3 (ARP32173_P050) antibody is Catalog # AAP32173 (Previous Catalog # AAPP23953)
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Yamamoto,T., (2007) J. Bone Miner. Metab. 25 (6), 407-413
• Publications:

  Starke, S., Cox, C., Südekum, K.-H. & Huber, K. Species-specific responses of N homeostasis and electrolyte handling to low N intake: a comparative physiological approach in a monogastric and a ruminant species. J. Comp. Physiol. B. 184, 137-47 (2014). 24129944

• Description:
  View product citations for SLC34A3 Antibody - middle region (ARP32173_P050) on CiteAb

Target Info

• Gene Symbol: SLC34A3
• Gene Full Name: Solute carrier family 34 (sodium phosphate), member 3
• Alias Symbols: HHRH, NPTIIc
• NCBI Gene Id: 142680
• Protein Name: Sodium-dependent phosphate transport protein 2C
• Description of Target: SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney.
• Uniprot ID: Q8N130
• Protein Accession #: NP_543153
• Nucleotide Accession #: NM_080877
• Protein Size (# AA): 599
• Molecular Weight: 64 kDa
• Protein Interactions: SNTA1; PDZK1;