Size:100 ul
$319.00
In stock
SKU
ARP43757_P050-HRP
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43757_P050 Unconjugated

ARP43757_P050-FITC Conjugated

ARP43757_P050-Biotin Conjugated

SLC2A9 Antibody - middle region : HRP (ARP43757_P050-HRP)

Catalog#: ARP43757_P050-HRP
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-105399 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SLC2A9
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 91%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 79%
Complete computational species homology data Anti-SLC2A9 (ARP43757_P050)
Peptide Sequence Synthetic peptide located within the following region: VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
Concentration 0.5 mg/ml
Blocking Peptide For anti-SLC2A9 (ARP43757_P050-HRP) antibody is Catalog # AAP43757 (Previous Catalog # AAPP25347)
Datasheets/Manuals Printable datasheet for anti-SLC2A9 (ARP43757_P050-HRP) antibody
Sample Type Confirmation

SLC2A9 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Brandstatter,A., (er) Diabetes Care (2008) In press
Publications

Gaccioli, F. et al. Maternal overweight induced by a diet with high content of saturated fat activates placental mTOR and eIF2 alpha signaling and increases fetal growth in rats. Biol. Reprod. 89, 96 (2013). WB, Human, Horse, Guinea pig, Mouse, Bovine, Dog, Rat, Rabbit 24006279

Gene Symbol SLC2A9
Official Gene Full Name Solute carrier family 2 (facilitated glucose transporter), member 9
Alias Symbols GLUT9, GLUTX, UAQTL2, URATv1
NCBI Gene Id 56606
Protein Name Solute carrier family 2, facilitated glucose transporter member 9
Description of Target SLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene.
Swissprot Id Q9NRM0
Protein Accession # NP_001001290
Nucleotide Accession # NM_001001290
Protein Size (# AA) 511
Molecular Weight 56kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SLC2A9.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SLC2A9.
Write Your Own Review
You're reviewing:SLC2A9 Antibody - middle region : HRP (ARP43757_P050-HRP)
Your Rating