Size:100 ul
$319.00
In Stock
SKU
ARP43757_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43757_P050 Unconjugated

ARP43757_P050-HRP Conjugated

ARP43757_P050-Biotin Conjugated

SLC2A9 Antibody - middle region : FITC (ARP43757_P050-FITC)

Catalog#: ARP43757_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-105399 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC2A9
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 91%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 79%
Complete computational species homology dataAnti-SLC2A9 (ARP43757_P050)
Peptide SequenceSynthetic peptide located within the following region: VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC2A9 (ARP43757_P050-FITC) antibody is Catalog # AAP43757 (Previous Catalog # AAPP25347)
Datasheets/ManualsPrintable datasheet for anti-SLC2A9 (ARP43757_P050-FITC) antibody
Sample Type Confirmation

SLC2A9 is supported by BioGPS gene expression data to be expressed in HepG2

Target ReferenceBrandstatter,A., (er) Diabetes Care (2008) In press
Publications

Gaccioli, F. et al. Maternal overweight induced by a diet with high content of saturated fat activates placental mTOR and eIF2 alpha signaling and increases fetal growth in rats. Biol. Reprod. 89, 96 (2013). WB, Human, Horse, Guinea pig, Mouse, Bovine, Dog, Rat, Rabbit 24006279

Gene SymbolSLC2A9
Official Gene Full NameSolute carrier family 2 (facilitated glucose transporter), member 9
Alias SymbolsGLUT9, GLUTX, UAQTL2, URATv1
NCBI Gene Id56606
Protein NameSolute carrier family 2, facilitated glucose transporter member 9
Description of TargetSLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene.
Swissprot IdQ9NRM0
Protein Accession #NP_001001290
Nucleotide Accession #NM_001001290
Protein Size (# AA)511
Molecular Weight56kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SLC2A9.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SLC2A9.
  1. What is the species homology for "SLC2A9 Antibody - middle region : FITC (ARP43757_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "SLC2A9 Antibody - middle region : FITC (ARP43757_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC2A9 Antibody - middle region : FITC (ARP43757_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC2A9 Antibody - middle region : FITC (ARP43757_P050-FITC)"?

    This target may also be called "GLUT9, GLUTX, UAQTL2, URATv1" in publications.

  5. What is the shipping cost for "SLC2A9 Antibody - middle region : FITC (ARP43757_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC2A9 Antibody - middle region : FITC (ARP43757_P050-FITC)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "SLC2A9 Antibody - middle region : FITC (ARP43757_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC2A9 Antibody - middle region : FITC (ARP43757_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SLC2A9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC2A9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC2A9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC2A9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC2A9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC2A9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC2A9 Antibody - middle region : FITC (ARP43757_P050-FITC)
Your Rating
Free Microscope
Aviva ChIP Antibodies
Aviva Tissue Tool
Aviva Pathways