SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP43757_P050
Price: $0.00
SKU
ARP43757_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SLC2A9 (ARP43757_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC2A9
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 91%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC2A9 (ARP43757_P050) antibody is Catalog # AAP43757 (Previous Catalog # AAPP25347)
Sample Type Confirmation

SLC2A9 is supported by BioGPS gene expression data to be expressed in HepG2

Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceBrandstatter,A., (er) Diabetes Care (2008) In press
Publications

Gaccioli, F. et al. Maternal overweight induced by a diet with high content of saturated fat activates placental mTOR and eIF2 alpha signaling and increases fetal growth in rats. Biol. Reprod. 89, 96 (2013). 24006279

Hormonal and Chemical Regulation of the Glut9 Transporter in Mice. J. Pharmacol. Exp. Ther. 360, 206-214 (2017). 27807007

Gene SymbolSLC2A9
Gene Full NameSolute carrier family 2 (facilitated glucose transporter), member 9
Alias SymbolsGLUT9, GLUTX, UAQTL2, URATv1
NCBI Gene Id56606
Protein NameSolute carrier family 2, facilitated glucose transporter member 9
Description of TargetSLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene.
Uniprot IDQ9NRM0
Protein Accession #NP_001001290
Nucleotide Accession #NM_001001290
Protein Size (# AA)511
Molecular Weight59 kDa
  1. What is the species homology for "SLC2A9 Antibody - middle region (ARP43757_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "SLC2A9 Antibody - middle region (ARP43757_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC2A9 Antibody - middle region (ARP43757_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC2A9 Antibody - middle region (ARP43757_P050)"?

    This target may also be called "GLUT9, GLUTX, UAQTL2, URATv1" in publications.

  5. What is the shipping cost for "SLC2A9 Antibody - middle region (ARP43757_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC2A9 Antibody - middle region (ARP43757_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC2A9 Antibody - middle region (ARP43757_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "59 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC2A9 Antibody - middle region (ARP43757_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC2A9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC2A9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC2A9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC2A9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC2A9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC2A9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC2A9 Antibody - middle region (ARP43757_P050)
Your Rating