Search Antibody, Protein, and ELISA Kit Solutions

SLC2A9 Antibody - middle region (ARP43757_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43757_P050-FITC Conjugated

ARP43757_P050-HRP Conjugated

ARP43757_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Solute carrier family 2 (facilitated glucose transporter), member 9
NCBI Gene Id:
Protein Name:
Solute carrier family 2, facilitated glucose transporter member 9
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-105399 from Santa Cruz Biotechnology.
Description of Target:
SLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC2A9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC2A9.
The immunogen is a synthetic peptide directed towards the middle region of human SLC2A9
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 91%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 79%
Complete computational species homology data:
Anti-SLC2A9 (ARP43757_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SLC2A9 (ARP43757_P050) antibody is Catalog # AAP43757 (Previous Catalog # AAPP25347)
Printable datasheet for anti-SLC2A9 (ARP43757_P050) antibody
Sample Type Confirmation:

SLC2A9 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Brandstatter,A., (er) Diabetes Care (2008) In press

Bu, P; Le, Y; Zhang, Y; Cheng, X; Hormonal and Chemical Regulation of the Glut9 Transporter in Mice. 360, 206-214 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27807007

Gaccioli, F. et al. Maternal overweight induced by a diet with high content of saturated fat activates placental mTOR and eIF2 alpha signaling and increases fetal growth in rats. Biol. Reprod. 89, 96 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24006279

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...