Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP43757_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43757_P050-FITC Conjugated

ARP43757_P050-HRP Conjugated

ARP43757_P050-Biotin Conjugated

SLC2A9 Antibody - middle region (ARP43757_P050)

Catalog#: ARP43757_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-105399 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SLC2A9
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 91%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 79%
Complete computational species homology data Anti-SLC2A9 (ARP43757_P050)
Peptide Sequence Synthetic peptide located within the following region: VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SLC2A9 (ARP43757_P050) antibody is Catalog # AAP43757 (Previous Catalog # AAPP25347)
Datasheets/Manuals Printable datasheet for anti-SLC2A9 (ARP43757_P050) antibody
Sample Type Confirmation

SLC2A9 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Brandstatter,A., (er) Diabetes Care (2008) In press
Publications

Bu, P; Le, Y; Zhang, Y; Cheng, X; Hormonal and Chemical Regulation of the Glut9 Transporter in Mice. 360, 206-214 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27807007

Gaccioli, F. et al. Maternal overweight induced by a diet with high content of saturated fat activates placental mTOR and eIF2 alpha signaling and increases fetal growth in rats. Biol. Reprod. 89, 96 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24006279

Gene Symbol SLC2A9
Official Gene Full Name Solute carrier family 2 (facilitated glucose transporter), member 9
Alias Symbols GLUT9, GLUTX, UAQTL2, URATv1
NCBI Gene Id 56606
Protein Name Solute carrier family 2, facilitated glucose transporter member 9
Description of Target SLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene.
Swissprot Id Q9NRM0
Protein Accession # NP_001001290
Nucleotide Accession # NM_001001290
Protein Size (# AA) 511
Molecular Weight 56kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SLC2A9.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SLC2A9.
Write Your Own Review
You're reviewing:SLC2A9 Antibody - middle region (ARP43757_P050)
Your Rating