Catalog No: ARP42096_P050
Price: $0.00
SKU
ARP42096_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SLC2A5 (ARP42096_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC2A5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 85%
Peptide SequenceSynthetic peptide located within the following region: ADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGF
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC2A5 (ARP42096_P050) antibody is Catalog # AAP42096 (Previous Catalog # AAPP24575)
Enhanced Validation
WBY
SPRY
YCHAROS
ReferenceFu,Y., (2004) Blood Cells Mol. Dis. 32 (1), 182-190
Gene SymbolSLC2A5
Gene Full NameSolute carrier family 2 (facilitated glucose/fructose transporter), member 5
Alias SymbolsGLUT5, GLUT-5
NCBI Gene Id6518
Protein NameSolute carrier family 2, facilitated glucose transporter member 5
Description of TargetSLC2A5 is a cytochalasin B-sensitive carrier. It seems to function primarily as a fructose transporter.
Uniprot IDP22732
Protein Accession #NP_003030
Nucleotide Accession #NM_003039
Protein Size (# AA)501
Molecular Weight55 kDa
Protein InteractionsCCL5; RPSA;
  1. What is the species homology for "SLC2A5 Antibody (ARP42096_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Sheep".

  2. How long will it take to receive "SLC2A5 Antibody (ARP42096_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC2A5 Antibody (ARP42096_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC2A5 Antibody (ARP42096_P050)"?

    This target may also be called "GLUT5, GLUT-5" in publications.

  5. What is the shipping cost for "SLC2A5 Antibody (ARP42096_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC2A5 Antibody (ARP42096_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC2A5 Antibody (ARP42096_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC2A5 Antibody (ARP42096_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC2A5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC2A5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC2A5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC2A5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC2A5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC2A5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC2A5 Antibody (ARP42096_P050)
Your Rating
We found other products you might like!