Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SLC27A6 antibody - middle region (ARP43781_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP43781_P050-FITC Conjugated

ARP43781_P050-HRP Conjugated

ARP43781_P050-Biotin Conjugated

Gene Symbol:
SLC27A6
NCBI Gene Id:
28965
Official Gene Full Name:
Solute carrier family 27 (fatty acid transporter), member 6
Protein Name:
Long-chain fatty acid transport protein 6
Swissprot Id:
Q9Y2P4
Protein Accession #:
NP_001017372
Nucleotide Accession #:
NM_001017372
Alias Symbols:
ACSVL2, DKFZp779M0564, FACVL2, FATP6, VLCS-H1
Replacement Item:
This antibody may replace item sc-91716 from Santa Cruz Biotechnology.
Description of Target:
SLC27A6 is a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.This gene encodes a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Protein Size (# AA):
619
Molecular Weight:
70kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC27A6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC27A6.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SLC27A6
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SLC27A6 (ARP43781_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ELAVL1; UBC; CUTC; CHD3; TMEM62; TNFRSF10C; VIM; GNB2L1;
Blocking Peptide:
For anti-SLC27A6 (ARP43781_P050) antibody is Catalog # AAP43781 (Previous Catalog # AAPP25370)
Datasheets/Manuals:
Printable datasheet for anti-SLC27A6 (ARP43781_P050) antibody
Sample Type Confirmation:

SLC27A6 is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Stelzl,U., (2005) Cell 122 (6), 957-968
Publications:

Gaccioli, F. et al. Maternal overweight induced by a diet with high content of saturated fat activates placental mTOR and eIF2 alpha signaling and increases fetal growth in rats. Biol. Reprod. 89, 96 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24006279

Tell us what you think about this item!

Write A Review
    Please, wait...