Search Antibody, Protein, and ELISA Kit Solutions

SLC27A6 Antibody - middle region (ARP43781_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43781_P050-FITC Conjugated

ARP43781_P050-HRP Conjugated

ARP43781_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-91716 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human SLC27A6
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SLC27A6 (ARP43781_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SLC27A6 (ARP43781_P050) antibody is Catalog # AAP43781 (Previous Catalog # AAPP25370)
Printable datasheet for anti-SLC27A6 (ARP43781_P050) antibody
Sample Type Confirmation:

SLC27A6 is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Stelzl,U., (2005) Cell 122 (6), 957-968

Gaccioli, F. et al. Maternal overweight induced by a diet with high content of saturated fat activates placental mTOR and eIF2 alpha signaling and increases fetal growth in rats. Biol. Reprod. 89, 96 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24006279

Gene Symbol:
Official Gene Full Name:
Solute carrier family 27 (fatty acid transporter), member 6
Alias Symbols:
NCBI Gene Id:
Protein Name:
Long-chain fatty acid transport protein 6
Description of Target:
SLC27A6 is a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.This gene encodes a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC27A6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC27A6.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...