Size:100 ul
$319.00
In Stock
SKU
ARP43818_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43818_P050 Unconjugated

ARP43818_P050-HRP Conjugated

ARP43818_P050-Biotin Conjugated

SLC25A4 Antibody - N-terminal region : FITC (ARP43818_P050-FITC)

Catalog#: ARP43818_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-11433 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology dataAnti-SLC25A4 (ARP43818_P050)
Peptide SequenceSynthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC25A4 (ARP43818_P050-FITC) antibody is Catalog # AAP43818 (Previous Catalog # AAPS14103)
Datasheets/ManualsPrintable datasheet for anti-SLC25A4 (ARP43818_P050-FITC) antibody
Sample Type Confirmation

SLC25A4 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Gene SymbolSLC25A4
Official Gene Full NameSolute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4
Alias SymbolsANT, ANT1, PEO2, PEO3, T1, AAC1
NCBI Gene Id291
Protein NameADP/ATP translocase 1
Description of TargetThis gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.
Swissprot IdQ05962
Protein Accession #NP_001142
Nucleotide Accession #NM_001151
Protein Size (# AA)298
Molecular Weight33kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SLC25A4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SLC25A4.
Protein InteractionsUBC; MDM2; PARK2; CLN5; CLN3; UBL4A; RPLP0P6; RPL10L; UQCRFS1P1; UQCRC1; RPS3A; RPS2; RPSA; GALNT2; UBD; COPS5; CDK2; TCF3; SUMO4; ICT1; NFKBIA; MGMT; PPID; PPIF; BAX; AR; PRKCE; NR3C1;
  1. What is the species homology for "SLC25A4 Antibody - N-terminal region : FITC (ARP43818_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish".

  2. How long will it take to receive "SLC25A4 Antibody - N-terminal region : FITC (ARP43818_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC25A4 Antibody - N-terminal region : FITC (ARP43818_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC25A4 Antibody - N-terminal region : FITC (ARP43818_P050-FITC)"?

    This target may also be called "ANT, ANT1, PEO2, PEO3, T1, AAC1" in publications.

  5. What is the shipping cost for "SLC25A4 Antibody - N-terminal region : FITC (ARP43818_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC25A4 Antibody - N-terminal region : FITC (ARP43818_P050-FITC)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "SLC25A4 Antibody - N-terminal region : FITC (ARP43818_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC25A4 Antibody - N-terminal region : FITC (ARP43818_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SLC25A4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC25A4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC25A4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC25A4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC25A4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC25A4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC25A4 Antibody - N-terminal region : FITC (ARP43818_P050-FITC)
Your Rating
Aviva Live Chat
Assay Development
Free Microscope
Aviva Validation Data